DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3097 and cpa1

Sequence 1:NP_572259.1 Gene:CG3097 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001107681.1 Gene:cpa1 XenbaseID:XB-GENE-960032 Length:420 Species:Xenopus tropicalis

Alignment Length:431 Identity:144/432 (33%)
Similarity:234/432 (54%) Gaps:37/432 (9%)


  Fly     7 LLQLLLLVAAVAASLANELPSNLTLLDANEIPQRY--DEAQLWRIYNISEAMQKRVPVGQMLEQK 69
            :|.||.||.| |:||.|        ....::.:.:  ||||:    |:..|::..    :.|:..
 Frog     4 ILALLALVVA-ASSLEN--------FSGQQVLRIFPSDEAQV----NLVRALEDE----EYLQLD 51

  Fly    70 FGGNIWKENSKFL---DISIARDQLKAARSFLSAHRLDPQILSHNIQSMIDEELLEGIQSSSFGH 131
            |    |...|:.|   ||.:....|::.:.:|.::.:...|:.|::|:::|||..:..::.:...
 Frog    52 F----WTSPSRVLLPIDIRVPLHHLQSVKVYLESNSIQYSIMIHDVQNLLDEEQRDMRRNRASED 112

  Fly   132 GRRTKKAARSSMHWKDYHDLETIYSFMREIRTKFPNIVRLYTIGQTAEGRDLKVLRISENPRENK 196
            ||.|     :|.::..||..:.|.:|:..:.::.||:|....||.:.|||.|.||:.|..| ...
 Frog   113 GRST-----NSFNYAAYHTFDEINAFIDNLVSENPNLVSKIQIGSSYEGRPLNVLKFSTGP-NRP 171

  Fly   197 KVWIDGGIHAREWISPATVTFILYQLMSDWENQPA---HIRGLTWYIMPVMNPDGYEYSRTTNRL 258
            ..|||.|||:|||::.|:..:...::::|:...|:   .:..:...|..|.||||:.|:..::|:
 Frog   172 AFWIDTGIHSREWVTQASAVWFAKKIVTDFGKDPSLTNTLNQMDILIEIVTNPDGFVYTHKSDRM 236

  Fly   259 WRKNRSPSRRAQCSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAPASERETRAVAEFLAKRKYNL 323
            |||.|||:..:.|.|.|.|||:|.|:.|.|||:|||::||||.|..||.|.:|:.:|: |...|:
 Frog   237 WRKTRSPNSGSLCVGTDPNRNWDAGFGGPGSSSNPCTETYRGRAAHSEPEVKAIVDFV-KSHGNI 300

  Fly   324 ESYLTFHSYGQMIVYPWAYKAVKVKDASVLQRVSSLAAERILQKTGTSYRAAVTHEVLGIAGGGS 388
            :.:::.|||.||:::|:.|...:|.|...|..||..|...:....||:|........:..|.||:
 Frog   301 KGFVSIHSYSQMLLFPYGYTNTRVPDHDELNAVSKKAITALASLYGTAYTYGSIISTIYQASGGT 365

  Fly   389 DDWSRAALGVKYVYTIELRDRGAYGFVLPPRFIKDTALEGW 429
            .||:... |:|:.|:.||||.|.|||.||...|..||.|.|
 Frog   366 IDWTYNQ-GIKHSYSFELRDTGRYGFALPANQIIPTAEETW 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 13/57 (23%)
M14_CP_A-B_like 148..439 CDD:199844 109/286 (38%)
cpa1NP_001107681.1 Propep_M14 27..99 CDD:280416 19/84 (23%)
MpaA 28..402 CDD:225421 132/394 (34%)
M14_CPA 119..418 CDD:133081 109/291 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69899865
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.