DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3097 and CG14820

Sequence 1:NP_572259.1 Gene:CG3097 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_648060.1 Gene:CG14820 FlyBaseID:FBgn0035718 Length:416 Species:Drosophila melanogaster

Alignment Length:435 Identity:137/436 (31%)
Similarity:222/436 (51%) Gaps:50/436 (11%)


  Fly     6 MLLQLLLLVAAVAASLANELPSNLTLLDANEIPQ-RYDEAQLWRIYNISEAMQKRVPVGQMLEQK 69
            |||::||:|.....              |..:.| |||.   :::||:.....::..:....|:.
  Fly     1 MLLKILLVVGLFGL--------------ARSVEQVRYDN---YKVYNVRIDDLEQFKLLHTQERS 48

  Fly    70 FGGNIWKENSKFL----DISIARDQLKAARSFLSAHRLDPQILSHNIQSMIDEELLEGIQSSSFG 130
            ...:.|:| ::.|    ||.:..:..|...|.|:.|.....:...|:|:.||             
  Fly    49 LKLSSWRE-ARHLGESSDIMLPPEYQKTFESLLTKHNFTYNLKIDNVQTHID------------- 99

  Fly   131 HGRRTKKAARSSMHWKDYHDLETIYSFMREIRTKFPNIVRLYTIGQTAEGRDLKVLRISENPREN 195
             .:|.|:.. :||.|..:|.||.||:::..|..::|:||..:|||.:.|||.::.::||.. ..|
  Fly   100 -AQRPKQRI-TSMEWTQFHTLEEIYAWLDVIEDRYPDIVTPFTIGNSYEGRPIRGVKISYK-EGN 161

  Fly   196 KKVWIDGGIHAREWISPATVTFILYQLMSDWENQPAHIRGLT----WYIMPVMNPDGYEYSRTTN 256
            ..|:|:..|||||||:.||:|:.:.:|:.  ...|| :|.:.    |||:||:|.||:.||....
  Fly   162 PAVFIESNIHAREWITSATITYFIDELLV--PRNPA-VRDIAQNVDWYIIPVLNTDGFAYSHEVE 223

  Fly   257 RLWRKNRSPS-RRAQCSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAPASERETRAVAEFLAKR- 319
            |||||:|.|| ...:|.|.|||||||..|...|:.::|||..|.|.:|.|:.|...:..::... 
  Fly   224 RLWRKSRLPSDPTGECIGTDLNRNFDYLWMLTGAESDPCSQLYAGPSPESDPEISQLTAYINNSI 288

  Fly   320 -KYNLESYLTFHSYGQMIVYPWAYKAVKVKD-ASVLQRVSSLAAERILQKTGTSYRAAVTHEVLG 382
             :..::.|::.|||||.::.||.:.|::..: ...:..|:...::.:.::.||.:....:...|.
  Fly   289 PEGTIKIYISLHSYGQYVLSPWGHTALEFPEHYPQMMHVAKGFSDALYRRYGTVFTYGSSATTLY 353

  Fly   383 IAGGGSDDWSRAALGVKYVYTIELRDRGAYGFVLPPRFIKDTALE 427
            ...|...:|:.|...:|..|||||||:|..||||||..|...|.|
  Fly   354 EVSGSGKEWAYAVKNIKIHYTIELRDKGELGFVLPPEDIIPVARE 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 14/58 (24%)
M14_CP_A-B_like 148..439 CDD:199844 105/289 (36%)
CG14820NP_648060.1 Propep_M14 31..100 CDD:280416 14/84 (17%)
M14_CP_A-B_like 115..410 CDD:199844 105/289 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71060376
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.