DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3097 and CG18585

Sequence 1:NP_572259.1 Gene:CG3097 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001260213.1 Gene:CG18585 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster

Alignment Length:431 Identity:143/432 (33%)
Similarity:231/432 (53%) Gaps:56/432 (13%)


  Fly     6 MLLQLLLLVAAVAASLANELPSNLTLLDANEIPQRYDEAQLWRIYNISEAMQKRVPVGQM----- 65
            :|..|..|||..:|.:..:.|.           :|||.   :|:|.::  :|.::.:..:     
  Fly     3 LLWLLATLVALTSAGILKDSPK-----------ERYDN---FRVYKLT--IQNKIQLAAIEKIGE 51

  Fly    66 LEQKFGGNIWK---ENSKFLDISIARDQLKAARSFLSAHRLDPQILSHNIQSMIDEE-LLEGIQS 126
            |.:|:  ||||   |.|:.:||.::..:|...:..|..:.:..:::..|:|..|||| :.....|
  Fly    52 LTKKY--NIWKEYDERSRQIDIMVSPGELNHFQELLKFNNISSELMIENVQERIDEEQVTPTADS 114

  Fly   127 SSFGHGRRTKKAARSSMHWKDYHDLETIYSFMREIRTKFPNIVRLYTIGQTAEGRDLKVLRISEN 191
            ::||              |..|::||.|.:::.||...:|::...:.:|::.|||.::.::|| :
  Fly   115 ATFG--------------WTKYYELEEIEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKIS-H 164

  Fly   192 PRENKKVWIDGGIHAREWISPATVTFILYQLMSDWENQPAHIRGLT----WYIMPVMNPDGYEYS 252
            ...|..::|:..|||||||:.|:.|:.:.||::   ::.|.:|.|.    |:|:||.|.||:|||
  Fly   165 KAGNPGIFIESNIHAREWITSASATWFINQLLT---SEDADVRSLADNYDWHIIPVFNVDGFEYS 226

  Fly   253 RTTNRLWRKNRSPSRRAQCSGVDLNRNFDIGW-NGYGSSTNPCSDTYRGSAPASERETRAVAEFL 316
            ...:|:|||.|.|.....|.|.|.|||||..| ...|:|.||||:|:.|..|.||.|.:|:.|:|
  Fly   227 HKKDRMWRKTRQPHATNACIGADANRNFDSYWLQNNGASDNPCSETFAGDNPESEPEAKALVEYL 291

  Fly   317 AKRKYNLESYLTFHSYGQMIVYPWAYK----AVKVKDASVLQRVSSLAAERILQKTGTSYRAAVT 377
            .|.:..:..|::||||||.::.|:.:.    .....|...:.:..:.|.|.:  ..||.|:...|
  Fly   292 TKIQDQISVYISFHSYGQYLLSPYGHTNEEFPENYNDILTIGKAFADAIEAL--PYGTVYQYGST 354

  Fly   378 HEVLGIAGGGSDDWSRAALGVKYVYTIELRDRGAYGFVLPP 418
            .:||.:|.|.|.||....||.|..||||.||:|.|||:|||
  Fly   355 ADVLYVATGTSVDWVFNELGKKIGYTIEYRDKGRYGFILPP 395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 16/62 (26%)
M14_CP_A-B_like 148..439 CDD:199844 108/281 (38%)
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 17/75 (23%)
M14_CP_A-B_like 122..415 CDD:199844 108/281 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71060074
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.