DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3097 and CG8945

Sequence 1:NP_572259.1 Gene:CG3097 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_573190.1 Gene:CG8945 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster

Alignment Length:504 Identity:138/505 (27%)
Similarity:237/505 (47%) Gaps:106/505 (21%)


  Fly    15 AAVAASLANEL-------------PSNLTLLDANEIPQR--YDEAQLWRIYNISE----AMQ--K 58
            :|::.|.:|.|             .|..|.....::|:|  ||:.|:||:....|    |::  |
  Fly   940 SAISTSTSNPLLQALATRMTTRGTTSTTTTTSRPDVPRRISYDKYQIWRLKPQDEEQVRALEEFK 1004

  Fly    59 RVPVGQMLEQKFGGNIWKENSKFLDISIARDQLKAARSFLSAHRLDPQILSHNIQSMIDEELL-- 121
            :...|..|:...|.::    ....|:.:....|...:..|:...:..::|..::...|..||.  
  Fly  1005 KGEDGVKLQWLKGPSL----RGLTDVLVPPKMLVDFQGTLNYEGIAHEVLIFDVGKAIAYELTKE 1065

  Fly   122 EGIQSSSFGHGRRTKKAARSSMHWKDYHDLETIYSFMREIRTKFPNIVRLYTIGQTAEGRDLKVL 186
            :.:|::.....|.|   |...|.|..||:.:.|..::..:|.:.|.:|.|..||::.|||.|.|:
  Fly  1066 DYLQTTRPSKPRPT---APPPMTWNRYHNHDEIVKYLETVRMRHPQLVELIHIGRSFEGRPLIVV 1127

  Fly   187 RIS----------------ENPRENKK------VWIDGGIHAREWISPATVTFILYQLM----SD 225
            :|.                :.|:..:|      |:::.|.....||.||..|:::.:|:    ::
  Fly  1128 KIESKQTAAAANNDGLHTIKRPKRKRKSGQANAVFVEAGAQGLAWIGPAAATWMIAELLRLMKTN 1192

  Fly   226 WENQPAH-IRGLTWYIMPVMNPDGYEYSRTTNRLWRKNRS------PS------------RRAQ- 270
            ..|:... ||..|||||||:|||||.||...:|.|:|:||      ||            :|.. 
  Fly  1193 KSNEDVEFIRNTTWYIMPVLNPDGYAYSHEYDRFWKKSRSQHQTPPPSGLLDSAMTWLQQKRGPD 1257

  Fly   271 --CSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAPASERETRAVAEFLAKRKYNLESYLTFHSYG 333
              |.||||:||:...|...|||..||::.|.|.||.||.||:||:|||...:..::.|::..:||
  Fly  1258 KVCYGVDLDRNWLYHWGKRGSSKAPCNEFYAGPAPFSEPETKAVSEFLMDYRTQIKLYISLQAYG 1322

  Fly   334 QMIVYPWAYKAVKVKDASVLQRVSSLAAERI-------------LQKTGTS--YRAAVTHEVLGI 383
            |:|.||     ||..        |:..:||:             |:|.|:.  |:...:::::..
  Fly  1323 QVISYP-----VKAN--------STFNSERLDDFLDVAMVGTDGLRKKGSKSRYKVDASNDLIEQ 1374

  Fly   384 AGGGSDDWSRAALGVKYVYTIELRDRGAYGFVLPPRFIKDTALEGWTVV 432
            ..|.:|.::...:|:.:.||::|.|.|.:|::||...|:.||.:.:.::
  Fly  1375 RSGCADAFAAYEIGIPFSYTLQLADNGVHGYLLPSSAIEPTARDAFEII 1423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 7/54 (13%)
M14_CP_A-B_like 148..439 CDD:199844 106/349 (30%)
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 11/74 (15%)
M14_CP_A-B_like 1089..1430 CDD:199844 106/349 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.