DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3097 and Y59C2A.1

Sequence 1:NP_572259.1 Gene:CG3097 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_494213.2 Gene:Y59C2A.1 WormBaseID:WBGene00021984 Length:454 Species:Caenorhabditis elegans

Alignment Length:375 Identity:130/376 (35%)
Similarity:207/376 (55%) Gaps:28/376 (7%)


  Fly    73 NIWKENSK---FLDISIARDQLKAARSFLSAHRLDP-QILSHNIQSMIDEELLEGIQSSSFGHGR 133
            :||.|.||   :.||.:|.:.|:..:|.|::..|.. ::|..:|||.|:.|....|::|.    |
 Worm    70 DIWAEPSKQNPYADILVAPEFLQKFKSLLTSAELSTLKMLEGDIQSQINAERHAMIRNSV----R 130

  Fly   134 RTKKAARSSMHWKD-----YHDLETIYSFMREIRTKFPNIVRLYTIGQTAEGRDLKVLRI---SE 190
            |.|:|.::   |::     ||....:..||:.:..:..::|.:..:..::|||.:..::|   ..
 Worm   131 RRKRAMKT---WQEFDTNAYHSYNEMVEFMKLLSEQKSDMVEMVKVATSSEGRSIYGVKIHPPGP 192

  Fly   191 NPRENKKVWIDGGIHAREWISPATVTFILYQLMSDWENQP---AHIRGLTWYIMPVMNPDGYEYS 252
            :|.|...:.:|.|:||||||:||...|::.:::.::...|   |:::...|||||.:||||||||
 Worm   193 SPPEKPSIIVDAGVHAREWIAPAVGLFMIRKIVEEYGRNPQVTANLQKFDWYIMPQVNPDGYEYS 257

  Fly   253 RTTNRLWRKNRSPSRRAQ--CSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAPASERETRAVAEF 315
            |||:|||||.||.:....  |.|.|.|||:...|...|::..|||:.|.||.|.||.|.|.:.||
 Worm   258 RTTDRLWRKTRSKNVTVNRWCVGADANRNWGYRWGEAGANRTPCSNIYMGSHPYSEPEIRGLKEF 322

  Fly   316 LAKRKYNLESYLTFHSYGQMIVYPWAYKAVKVKDASVLQRVSSLAAERILQKTGTSYRAAVTHEV 380
            ...:..|...|::.|||||:::.||.|...:.::....|..:..||:.|...||.||......|:
 Worm   323 FTWQITNPMVYISLHSYGQLLLSPWGYTNERTENYQDQQNAAKEAAQAIKNTTGVSYSYGTISEM 387

  Fly   381 LGIAGGGSDDWSRAALGVKYVYTIELR---DRGAYGFVLPPRFIKDTALE 427
            :..|.|.|.|:.:.. ||.|:|.:|||   :..::.|.|||.:|:.|..|
 Worm   388 MYPASGTSIDFMQHR-GVPYIYGVELRPTDNPNSFAFNLPPSYIRATGDE 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 17/49 (35%)
M14_CP_A-B_like 148..439 CDD:199844 105/292 (36%)
Y59C2A.1NP_494213.2 Propep_M14 <69..119 CDD:280416 17/49 (35%)
M14_CP_A-B_like 147..448 CDD:199844 105/292 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5063740
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128876
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.