DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3097 and Cpb2

Sequence 1:NP_572259.1 Gene:CG3097 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_446069.1 Gene:Cpb2 RGDID:71035 Length:422 Species:Rattus norvegicus

Alignment Length:433 Identity:161/434 (37%)
Similarity:230/434 (53%) Gaps:52/434 (12%)


  Fly    12 LLVAAVAASLANELPSNLTLLDANEIPQRYDEAQLWRIYNISEAMQKRVPV-GQMLEQKFGGNIW 75
            :|.|....|...:|..|||        ..| |..||:            || .:.:|:|      
  Rat    27 VLSALPRTSRQVQLLQNLT--------TTY-EVVLWQ------------PVTAEFIEKK------ 64

  Fly    76 KENSKFLDISIARDQLKAARSFLSAHRLDPQILSHNIQSMIDEELLEGIQSSSFGHGRRTKKAAR 140
            ||...|::.|    .:.:.:::|:|.|:...:|.:|::.:|.:      |:|:     .|.....
  Rat    65 KEVHFFVNAS----DVNSVKAYLNASRIPFNVLMNNVEDLIQQ------QTSN-----DTVSPRA 114

  Fly   141 SSMHWKDYHDLETIYSFMREIRTKFPNIVRLYTIGQTAEGRDLKVLRIS-ENPRENKKVWIDGGI 204
            ||.:::.||.|..|||::..|..:.|::::...||.:.|...|.||::| :..|....:|||.||
  Rat   115 SSSYYEQYHSLNEIYSWIEVITEQHPDMLQKIYIGSSYEKYPLYVLKVSGKEHRVKNAIWIDCGI 179

  Fly   205 HAREWISPA-TVTFILY--QLMSDWENQPAHIRGLTWYIMPVMNPDGYEYSRTTNRLWRKNRSPS 266
            ||||||||| .:.||.|  |...........:|.:.:|||||||.|||:|:...||:||||||..
  Rat   180 HAREWISPAFCLWFIGYVTQFHGKENTYTRLLRHVDFYIMPVMNVDGYDYTWKKNRMWRKNRSVH 244

  Fly   267 RRAQCSGVDLNRNF-DIGWNGYGSSTNPCSDTYRGSAPASERETRAVAEFLAKRKYNLESYLTFH 330
            ...:|.|.|||||| ...|...|:|:..||:||.|..|.||.|.:|||:||.:...::::|::.|
  Rat   245 MNNRCVGTDLNRNFASKHWCEKGASSFSCSETYCGLYPESEPEVKAVADFLRRNINHIKAYISMH 309

  Fly   331 SYGQMIVYPWAYKAVKVKDASVLQRVSSLAAERI--LQKTGTSYRAAVTHEVLGIAGGGSDDWSR 393
            ||.|.|::|::|...|.||...|..|:|.|...|  :.| .|.|......|.|.:|.||||||. 
  Rat   310 SYSQQILFPYSYNRSKSKDHEELSLVASEAVRAIESINK-NTRYTHGSGSESLYLAPGGSDDWI- 372

  Fly   394 AALGVKYVYTIELRDRGAYGFVLPPRFIKDTALEGWTVVETVA 436
            ..||:||.:||||||.|.|||:||.||||.|..|....|..:|
  Rat   373 YDLGIKYSFTIELRDTGRYGFLLPERFIKPTCAEALAAVSKIA 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 12/54 (22%)
M14_CP_A-B_like 148..439 CDD:199844 131/297 (44%)
Cpb2NP_446069.1 Propep_M14 32..103 CDD:280416 23/102 (23%)
M14_CPB2 118..419 CDD:199868 131/301 (44%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 180..183 3/3 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 255..256 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 310..311 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70972060
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 1 1.000 T131305
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.645 Consistency score
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.