DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3097 and LOC105947369

Sequence 1:NP_572259.1 Gene:CG3097 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_012818774.2 Gene:LOC105947369 ID: Length:419 Species:Xenopus tropicalis

Alignment Length:444 Identity:131/445 (29%)
Similarity:222/445 (50%) Gaps:42/445 (9%)


  Fly     6 MLLQLLLLVAAVAASLANELPSNLTLLDANEIPQRYDEAQLWRIYNISEAMQKRVPVGQMLEQKF 70
            :::..:::||::||.......:...|   ...||..::.|.  |.:::..||.            
 Frog     3 IVILFVVIVASLAAPFIRRFDNEKAL---RVFPQNEEDVQF--IKHLARVMQL------------ 50

  Fly    71 GGNIWKENSK-------FLDISIARDQLKAARSFLSAHRLDPQILSHNIQSMIDEELLEGIQSSS 128
              |.||.:|.       |:|.....:........|....:..:||..|:|..|:.:|      |.
 Frog    51 --NFWKPHSSSYVIPKAFVDFHANAEDSHIITGLLEEKGIKHRILFQNLQEAIENQL------SK 107

  Fly   129 FGHGRRTKKAARSSMHWKDYHDLETIYSFMREIRTKFPNIVRLYTIGQTAEGRDLKVLRISENPR 193
            .|:.:..:..:.....|.:      |.::...:..|:||:|.:...|.|.||:.:.||::.....
 Frog   108 AGNPKDERFPSPRYRTWLE------ISTWAYRVSVKYPNLVSVVQAGNTYEGQTILVLKVGSQSA 166

  Fly   194 ENKKVWIDGGIHAREWISPATVTFILYQLMSDWENQPAH---IRGLTWYIMPVMNPDGYEYSRTT 255
            ..|.:.::.|:|||||||||...:.:.:.:..:....|.   :..:|::::||.|.|||.::.|.
 Frog   167 HKKGIVLECGVHAREWISPAFCQWFVNEAIRSYGKDKAMTKLLNSVTFHVVPVFNVDGYIWTWTH 231

  Fly   256 NRLWRKNRSPSRRAQCSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAPASERETRAVAEFLAKRK 320
            :|:|||||......:|.||||||||:..|....|:..|||:.|.||.|.||.||:|||.::....
 Frog   232 DRMWRKNRYQDANNKCVGVDLNRNFNASWGTGFSNDEPCSEIYAGSGPESENETKAVASYIRDNI 296

  Fly   321 YNLESYLTFHSYGQMIVYPWAYKAVKVKDASVLQRVSSLAAERILQKTGTSYRAAVTHEVLGIAG 385
            .:|::|::||:||||::||:.||:.|..::..|.:::..|.:.:....||||........:....
 Frog   297 SSLKAYISFHAYGQMLMYPYGYKSEKPPNSKKLDKIAVSALKALSTLYGTSYTHGPIATTIYPVS 361

  Fly   386 GGSDDWSRAALGVKYVYTIELRDRGAYGFVLPPRFIKDTALEGWTVVETVAQAI 439
            |.|.||:... |:||.:..||||.|.|||:||...||.|.:|....|:.:|:::
 Frog   362 GSSIDWAYDE-GMKYSFAFELRDEGQYGFLLPENQIKKTCMETMLAVKAIAKSV 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 12/61 (20%)
M14_CP_A-B_like 148..439 CDD:199844 104/294 (35%)
LOC105947369XP_012818774.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.