DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15771 and hdhd3

DIOPT Version :8

Sequence 1:NP_001284909.1 Gene:CG15771 / 31500 FlyBaseID:FBgn0029801 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001072693.1 Gene:hdhd3 / 780150 XenbaseID:XB-GENE-969463 Length:189 Species:Xenopus tropicalis

Alignment Length:156 Identity:28/157 (18%)
Similarity:54/157 (34%) Gaps:59/157 (38%)


  Fly    26 IRAFYFDLDNTLIPTRAGDSKAIRKLADFLETQYQFSKDDATQATQNFLKAFRR--C--PDNSQT 86
            :|...:|:.:||:..|                        .....|.|.:|.|:  |  |.:.:|
 Frog     3 LRLITWDIKDTLLRVR------------------------VPVGQQYFAEAKRQGLCMDPGSLET 43

  Fly    87 SL-DSWRTHL-------WRESLPARH---------------------KHLAEQIYPKWLKLRYRY 122
            |. :::|||.       ..:.:.:|.                     :.:|:|:|..:...| .:
 Frog    44 SFRNAYRTHSRLFPNYGLAQGMDSRQWWLDVVLQTFRLSGAEDDETVRSVAQQLYQDFSTAR-NW 107

  Fly   123 LAVPADYVQLLLRMRQAGYALALITN 148
            ..||... :.|...:..|..:|:|:|
 Frog   108 AVVPGAR-EALDSCKGLGLKMAVISN 132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15771NP_001284909.1 CTE7 25..255 CDD:274057 28/157 (18%)
HAD-SF-IA-v1 31..218 CDD:273686 27/152 (18%)
hdhd3NP_001072693.1 DREG-2 4..>139 CDD:274056 28/156 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.