DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15771 and Nanp

DIOPT Version :8

Sequence 1:NP_001284909.1 Gene:CG15771 / 31500 FlyBaseID:FBgn0029801 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001009409.1 Gene:Nanp / 311530 RGDID:1306009 Length:248 Species:Rattus norvegicus

Alignment Length:242 Identity:77/243 (32%)
Similarity:123/243 (51%) Gaps:23/243 (9%)


  Fly    24 AKIRAFYFDLDNTLIPTRAGDSKAIRKLADFLETQYQFSKDDATQATQNFLKAFRRCPDNSQTSL 88
            :::||.:||||||||.|.....:.:.::...|:::|.:.::......:..:|..:.|.....|.:
  Rat     4 SRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEVICDKVQVKLSKECFHPYSTCI 68

  Fly    89 DSWRTHLWRESLP-----ARHKHLAEQIYPKWLKLRYRYLAVPADYVQLLLRMRQAGYALALITN 148
            ...||..|.|::.     |.::.|||:.|..|...|.:::.:..|...:|..:|:. ..|.|:||
  Rat    69 TDVRTSHWEEAIQETKGGADNRKLAEECYFLWKSTRLQHMTLEEDVKAMLTELRKE-VRLLLLTN 132

  Fly   149 GPSNAQWEKVAELNVRGYFDCVLVSSDLPWEKPHPEIFYAACNFLNVKPQECVMIGDKLETDIKG 213
            |....|.||:.....:.|||.::|..:...|||.|.|||..|:.|.|:|.:|||:||.|||||:|
  Rat   133 GDRQTQREKIEACACQSYFDAIVVGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTLETDIQG 197

  Fly   214 GHLAQLGLTFW------TPLSNSSAAAQSLEDVEYKPHVKLGSLLEM 254
            |..|.|..|.|      .||::|.           .||..:.|:||:
  Rat   198 GLNAGLKATVWINKSGGVPLTSSP-----------MPHYMVSSVLEL 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15771NP_001284909.1 CTE7 25..255 CDD:274057 77/242 (32%)
HAD-SF-IA-v1 31..218 CDD:273686 64/192 (33%)
NanpNP_001009409.1 CTE7 6..234 CDD:274057 77/241 (32%)
Substrate binding. {ECO:0000250} 12..14 2/2 (100%)
HAD_like <114..239 CDD:304363 49/133 (37%)
Substrate binding. {ECO:0000250} 131..132 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C156067947
eggNOG 1 0.900 E1_COG1011
Hieranoid 1 1.000
Homologene 1 1.000 H12112
Inparanoid 1 1.050 131 1.000 Inparanoid score I4463
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004597
OrthoInspector 1 1.000 T1089156
orthoMCL 1 0.900 OOG5_130507
Panther 1 1.100 LDO PTHR46470
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.760

Return to query results.
Submit another query.