DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15771 and Ephx2

DIOPT Version :8

Sequence 1:NP_001284909.1 Gene:CG15771 / 31500 FlyBaseID:FBgn0029801 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_031966.2 Gene:Ephx2 / 13850 MGIID:99500 Length:554 Species:Mus musculus

Alignment Length:315 Identity:65/316 (21%)
Similarity:124/316 (39%) Gaps:87/316 (28%)


  Fly    26 IRAFYFDLDNTL-IPTRAG----DSKAIRKLADFLETQYQFSKDDATQATQNFLKAFRRCPDNSQ 85
            :|...||||..| :|:.||    ..:|:....|||...||....:.  .|:..:|        .:
Mouse     3 LRVAAFDLDGVLALPSIAGAFRRSEEALALPRDFLLGAYQTEFPEG--PTEQLMK--------GK 57

  Fly    86 TSLDSW---RTHLWRESLPARHKHLAE-----QIYPKWLKLRYRYLAVPADYVQLLLRMRQAGYA 142
            .:...|   ....:|:|..|...:|.|     ||:.:.:..|    ::....:|..:.:::.|:.
Mouse    58 ITFSQWVPLMDESYRKSSKACGANLPENFSISQIFSQAMAAR----SINRPMLQAAIALKKKGFT 118

  Fly   143 LALITNGPSNAQW-------EKVAEL--NVRGYFDCVLVSSDLPWEKPHPEIFYAACNFLNVKPQ 198
            ..::||     .|       :.:|::  .:..:||.::.|..:...||.|:|:....:.|..||.
Mouse   119 TCIVTN-----NWLDDGDKRDSLAQMMCELSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPN 178

  Fly   199 ECVMIGDKLETDIKGGHLAQLGLTFWTPLSNSSAAAQSLEDVEYKPHVKLGSLLEMYKYFPRLNS 263
            |.|.: |...:::|...  .:|:.  |.|.:::|:|  |.::|                  ::..
Mouse   179 EVVFL-DDFGSNLKPAR--DMGMV--TILVHNTASA--LRELE------------------KVTG 218

  Fly   264 VALPEMP-------------SVSRRRGSHMSPISQGSGSGSSSSAICVPGAGHGY 305
            ...||.|             .|:.:.|..:..:..|||     .|:|:   .||:
Mouse   219 TQFPEAPLPVPCNPNDVSHGYVTVKPGIRLHFVEMGSG-----PALCL---CHGF 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15771NP_001284909.1 CTE7 25..255 CDD:274057 53/251 (21%)
HAD-SF-IA-v1 31..218 CDD:273686 45/209 (22%)
Ephx2NP_031966.2 Phosphatase 1..224 55/265 (21%)
HAD-SF-IA-v3 5..203 CDD:273662 48/222 (22%)
HAD_like <111..203 CDD:119389 22/102 (22%)
Phosphate binding. {ECO:0000250|UniProtKB:P34913} 123..124 1/1 (100%)
Epoxide hydrolase 233..554 9/42 (21%)
Abhydrolase 239..>379 CDD:304388 9/36 (25%)
Abhydrolase_1 257..530 CDD:278959 4/13 (31%)
Microbody targeting signal. {ECO:0000255} 552..554
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1011
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.