DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lin-52 and LIN52

Sequence 1:NP_001284908.1 Gene:lin-52 FlyBaseID:FBgn0029800 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_011535622.1 Gene:LIN52 HGNCID:19856 Length:183 Species:Homo sapiens

Alignment Length:84 Identity:29/85 (34%)
Similarity:48/85 (56%) Gaps:1/85 (1%)


  Fly    52 EDELISMETL-RPSPVQWPERFPGMDEFLSMSDTPMYTRSTNYTSNLTDDDMVKINELAQLPPED 115
            |..|:|.|.| |.||..|||:.||:.||.:...:|:.:....:.:.:..||:..:.||..|...:
Human    47 EASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLKELGSLTTAN 111

  Fly   116 LIDKIKSMHDEIYQLGLRE 134
            |::|::.:.:..|||||.|
Human   112 LMEKVRGLQNLAYQLGLDE 130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lin-52NP_001284908.1 LIN52 55..147 CDD:287062 28/82 (34%)
LIN52XP_011535622.1 LIN52 50..130 CDD:287062 27/80 (34%)
GVQW 135..177 CDD:290611
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166191379
eggNOG 1 0.900 E1_KOG4402
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5203
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005092
OrthoInspector 1 1.000 T1075505
orthoMCL 1 0.900 OOG5_136367
Panther 1 1.100 LDO PTHR31489
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5845
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.