DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lin-52 and lin52

Sequence 1:NP_001284908.1 Gene:lin-52 FlyBaseID:FBgn0029800 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001071264.1 Gene:lin52 ZFINID:ZDB-GENE-061110-82 Length:112 Species:Danio rerio

Alignment Length:105 Identity:42/106 (40%)
Similarity:61/106 (58%) Gaps:4/106 (4%)


  Fly    52 EDELISMETL-RPSPVQWPERFPGMDEFLSMSDTPMYTRSTNYTSNLTDDDMVKINELAQLPPED 115
            |..|||:|.| |.||..|||:.||:.||.:....|:......:.:.|..:|:..:.||..|...:
Zfish    11 ESSLISLENLDRASPDLWPEQLPGVSEFAASFKNPITNSPPKWMAELESEDIEMLKELGSLTTAN 75

  Fly   116 LIDKIKSMHDEIYQLGLREAMEMTRGKLLGIFDRDRAPKR 155
            |::|:|.:.:..|||||.|:.||||||.|.|.:|   ||:
Zfish    76 LMEKVKGLQNLAYQLGLEESREMTRGKFLNILER---PKK 112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lin-52NP_001284908.1 LIN52 55..147 CDD:287062 38/93 (41%)
lin52NP_001071264.1 LIN52 14..107 CDD:287062 38/93 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166193766
eggNOG 1 0.900 E1_KOG4402
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5133
OMA 1 1.010
OrthoDB 1 1.010 D1513733at2759
OrthoFinder 1 1.000 FOG0005092
OrthoInspector 1 1.000 T1054740
orthoMCL 1 0.900 OOG5_136367
Panther 1 1.100 LDO PTHR31489
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5845
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.