DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lin-52 and Gm7020

Sequence 1:NP_001284908.1 Gene:lin-52 FlyBaseID:FBgn0029800 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_006534680.1 Gene:Gm7020 MGIID:3645610 Length:116 Species:Mus musculus

Alignment Length:105 Identity:38/106 (36%)
Similarity:61/106 (58%) Gaps:4/106 (4%)


  Fly    52 EDELISMETLR-PSPVQWPERFPGMDEFLSMSDTPMYTRSTNYTSNLTDDDMVKINELAQLPPED 115
            |..|:|.|.|. .||..|||:.||:.||.:...:|:.:....:.:.:..||:..:.||..|...:
Mouse    15 EASLLSFEKLDCASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLKELGSLTTAN 79

  Fly   116 LIDKIKSMHDEIYQLGLREAMEMTRGKLLGIFDRDRAPKR 155
            |::|::.:.:..|||||.|:.||||||.|.|.::   ||:
Mouse    80 LMEKVRGLQNLAYQLGLDESREMTRGKFLNILEK---PKK 116

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lin-52NP_001284908.1 LIN52 55..147 CDD:287062 35/93 (38%)
Gm7020XP_006534680.1 LIN52 18..111 CDD:287062 35/93 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5232
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005092
OrthoInspector 1 1.000 T1085613
orthoMCL 1 0.900 OOG5_136367
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5845
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.