DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lin-52 and lin52

Sequence 1:NP_001284908.1 Gene:lin-52 FlyBaseID:FBgn0029800 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001016782.1 Gene:lin52 XenbaseID:XB-GENE-5889227 Length:112 Species:Xenopus tropicalis

Alignment Length:105 Identity:40/106 (38%)
Similarity:63/106 (59%) Gaps:4/106 (4%)


  Fly    52 EDELISMETL-RPSPVQWPERFPGMDEFLSMSDTPMYTRSTNYTSNLTDDDMVKINELAQLPPED 115
            |..|:|.|.| |.||..|||:.||:.||.:...:|:.:....:.:.|.:||:..:.||..|...:
 Frog    11 ETSLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPIKSTPRKWMAELENDDIDMLKELGSLTTAN 75

  Fly   116 LIDKIKSMHDEIYQLGLREAMEMTRGKLLGIFDRDRAPKR 155
            |::|::.:.:..|||||.|:.||||||.|.|.::   ||:
 Frog    76 LMEKVRGLQNLAYQLGLDESREMTRGKFLNILEK---PKK 112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lin-52NP_001284908.1 LIN52 55..147 CDD:287062 37/93 (40%)
lin52NP_001016782.1 LIN52 14..107 CDD:287062 37/93 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166195609
eggNOG 1 0.900 E1_KOG4402
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1513733at2759
OrthoFinder 1 1.000 FOG0005092
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.