DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lin-52 and Lin52

Sequence 1:NP_001284908.1 Gene:lin-52 FlyBaseID:FBgn0029800 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_006225909.1 Gene:Lin52 RGDID:1306798 Length:157 Species:Rattus norvegicus

Alignment Length:128 Identity:35/129 (27%)
Similarity:58/129 (45%) Gaps:23/129 (18%)


  Fly    52 EDELISMETL-RPSPVQWPERFPGMDEFLSMSDTPMYTRSTNYTSNLTDDDMVKINELAQLPPED 115
            |..|:|.|.| |.||..|||:.||:.||.:...:|:.:....:.:.:..||:..:.||..|...:
  Rat    15 EASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPTWMAEIERDDIDMLKELGSLTTAN 79

  Fly   116 LIDKIKSMHDEIYQLGLREAMEMT----------------------RGKLLGIFDRDRAPKRQ 156
            |::|::.:.:..|||||.|..:..                      .|.||.:.|.:...||:
  Rat    80 LMEKVRGLQNLAYQLGLDECKDKPSEGSSRCFQLSVDSHQQSTPAGAGSLLPLLDFELHAKRK 142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lin-52NP_001284908.1 LIN52 55..147 CDD:287062 31/115 (27%)
Lin52XP_006225909.1 LIN52 18..100 CDD:287062 28/82 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166193343
eggNOG 1 0.900 E1_KOG4402
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1513733at2759
OrthoFinder 1 1.000 FOG0005092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31489
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.900

Return to query results.
Submit another query.