DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lin-52 and Lin52

Sequence 1:NP_001284908.1 Gene:lin-52 FlyBaseID:FBgn0029800 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_006515764.1 Gene:Lin52 MGIID:3045391 Length:126 Species:Mus musculus

Alignment Length:84 Identity:29/85 (34%)
Similarity:48/85 (56%) Gaps:1/85 (1%)


  Fly    52 EDELISMETL-RPSPVQWPERFPGMDEFLSMSDTPMYTRSTNYTSNLTDDDMVKINELAQLPPED 115
            |..|:|.|.| |.||..|||:.||:.||.:...:|:.:....:.:.:..||:..:.||..|...:
Mouse    15 EASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLKELGSLTTAN 79

  Fly   116 LIDKIKSMHDEIYQLGLRE 134
            |::|::.:.:..|||||.|
Mouse    80 LMEKVRGLQNLAYQLGLDE 98

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lin-52NP_001284908.1 LIN52 55..147 CDD:287062 28/82 (34%)
Lin52XP_006515764.1 LIN52 18..98 CDD:287062 27/80 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166191967
eggNOG 1 0.900 E1_KOG4402
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31489
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.900

Return to query results.
Submit another query.