DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lin-52 and lin-52

Sequence 1:NP_001284908.1 Gene:lin-52 FlyBaseID:FBgn0029800 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001255033.1 Gene:lin-52 WormBaseID:WBGene00003035 Length:161 Species:Caenorhabditis elegans

Alignment Length:135 Identity:34/136 (25%)
Similarity:63/136 (46%) Gaps:24/136 (18%)


  Fly    21 DEEV-------EKASASSSSTLLAEKDVPEVKERPITPEDELISMETLRPSPVQWPERFPGMDEF 78
            |:|:       :|::|..:..|..:|.:.|..| .:..|.|.:.|:.|     .:.|.|  ..|.
 Worm    14 DDEMFVQQMIEKKSNAEQAKMLEQQKKMLECTE-TMPEESEPVPMKCL-----DFEEAF--QSES 70

  Fly    79 LSMSDTPMYTRSTNYTSNLT--DDDMVKINELAQLPPEDLIDKIKSMHDEIYQLGLREAMEMTRG 141
            :|......|       .|::  .:|.|.:|.::..|.:|:...|:::.:.:|.||:.||.:..||
 Worm    71 VSKGYESPY-------KNISFLKEDAVTVNTMSHCPADDIAKLIRNIQNSVYTLGIEEARQCRRG 128

  Fly   142 KLLGI 146
            |||.:
 Worm   129 KLLNV 133

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lin-52NP_001284908.1 LIN52 55..147 CDD:287062 24/95 (25%)
lin-52NP_001255033.1 LIN52 <86..134 CDD:287062 13/50 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C165913663
eggNOG 1 0.900 E1_KOG4402
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005092
OrthoInspector 1 1.000 T476484
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31489
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.890

Return to query results.
Submit another query.