DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15772 and jazf1a

DIOPT Version :8

Sequence 1:NP_001284907.1 Gene:CG15772 / 31498 FlyBaseID:FBgn0029799 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_005159575.1 Gene:jazf1a / 561144 ZFINID:ZDB-GENE-060503-492 Length:292 Species:Danio rerio

Alignment Length:47 Identity:10/47 - (21%)
Similarity:24/47 - (51%) Gaps:11/47 - (23%)


  Fly    74 QQQHLQQQQHHQLQ----------QQQQQQQHQQLASNMSLLTVKGG 110
            ::|.|||..:..|.          :::|:.|.:::...:: ::|.||
Zfish   105 ERQELQQPTYVALSYINRFMTEAARREQETQKKKVQPKIA-ISVTGG 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15772NP_001284907.1 TMV_coat 114..>197 CDD:250082
jazf1aXP_005159575.1 FOXP-CC 68..>111 CDD:292777 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5189
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.