powered by:
                   
 
    
    
             
          
            Protein Alignment CG15772 and CG12054
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001284907.1 | Gene: | CG15772 / 31498 | FlyBaseID: | FBgn0029799 | Length: | 259 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_651853.1 | Gene: | CG12054 / 43694 | FlyBaseID: | FBgn0039831 | Length: | 628 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 113 | Identity: | 39/113 - (34%) | 
          
            | Similarity: | 44/113 -  (38%) | Gaps: | 38/113 - (33%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    17 MPSQVASNTGTPAPS------------AGGIHQQHQQQQHQQHQQQ-----QHQQQQHQQHQQQQ 64:|:.|.....|||.|            ..|..||.|.......::.     |...|..||.||||
 Fly   456 LPNLVNLGILTPATSPTKNTQTLTFTTTNGSTQQQQALVASLSKKTNILLLQEPTQLVQQVQQQQ 520
 
 
  Fly    65 QQQHQHQQQQQQHLQQQQHHQL--------------------QQQQQQ 92|||.|.|||.||.: |||||.|                    ||||||
 Fly   521 QQQQQQQQQLQQQV-QQQHHVLPISPTSSVSGNSSKSSSPTPQQQQQQ 567
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
          
          
            | Gene | Sequence | Domain | Region | External ID | Identity | 
          
            | CG15772 | NP_001284907.1 | TMV_coat | 114..>197 | CDD:250082 |  | 
          
            | CG12054 | NP_651853.1 | SFP1 | <123..231 | CDD:227516 |  | 
          | Blue background indicates that the domain is not in
              the aligned region. | 
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_COG5189 | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 0 | 0.000 | Not matched by this tool. | 
          
            | Phylome | 0 | 0.000 | Not matched by this tool. | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 1 | 0.900 |  | 
        
      
           
             Return to query results.
             Submit another query.