DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4078 and CG11403

Sequence 1:NP_001259262.1 Gene:CG4078 FlyBaseID:FBgn0029798 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_569898.1 Gene:CG11403 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster

Alignment Length:886 Identity:222/887 (25%)
Similarity:367/887 (41%) Gaps:195/887 (22%)


  Fly    13 FPFEPYPVQRAYMEKVIHCLRDGTNGVLESPTGTGKTLSLLCSSLAWI----------------- 60
            ||:.||.:|...|:::...|..|..|:.||||||||:|:|.|.:|.|:                 
  Fly    20 FPYSPYEIQEQLMQELFQVLERGQVGIFESPTGTGKSLTLTCGALTWLARHEELVRTEMLARIRG 84

  Fly    61 -------------------------RTRQSE-----HQKQMVKMEKADFSGLGGGAP-------- 87
                                     |.:::|     |.:.::..::.....:..||.        
  Fly    85 VEQELAKLKEESEQSSNWLESQGKSRAQRAELLRLQHLQALLDKQEQQLDQIRKGAKKHKRQGRV 149

  Fly    88 -GGDLSELAKTM------------------GRANNWGVPKVIYASRTHSQLTQAMRELKRTAYA- 132
             .|.|.||.|.:                  ...:.:...::.:.|||||||.|.:.||::|.:. 
  Fly   150 HPGKLEELEKDLDPESDSDSEHETADGPQEAAEDRYRPVQIFFCSRTHSQLAQIVAELRKTPHGQ 214

  Fly   133 NMRSVVLGSRDQLCIHPEVMR----------------EQGNSNKTNMCKLRVHSKT-CSFQMR-- 178
            ::||:.||||.|||.:|.|.:                ::...|.:...:|...:.: |.|:..  
  Fly   215 SVRSISLGSRQQLCGNPAVRKLKHVGLMNERCLDMATKKARPNPSKKSRLTAEANSRCPFKAASL 279

  Fly   179 VESRKDHPDLRGPTIMDIEDLVKVGQRLKICPYFASRELVPQADITFMPYNYLLDPKARKANKIE 243
            |||.:|.. |..|  :|||:|...|.....|.|:|||..|..|.:..:||..||...||....|.
  Fly   280 VESLRDLA-LTEP--LDIEELANEGTACGGCSYYASRSAVEHAQLILLPYQLLLQKSARNQLGIS 341

  Fly   244 LGNTIVILDEAHNIEKICEESASVQIKSSDVA-MAIEDVTHIMQVFASGESQDMAGDEPKDFTLD 307
            |..:|||:|||||:     ..:..|:..|::: ..:|..    :|..||.....    .|.||..
  Fly   342 LKGSIVIVDEAHNL-----LDSVAQLHGSEISRQQLERA----KVQISGYKDHF----QKRFTTK 393

  Fly   308 DLTLLKEMLLELEKAIDAIVVDNAVDGTTFPASMM--YELLGKANFTYGNVATI----------- 359
            :|..:.:::..:.:.:.  ::|...:..:...|||  |||..:.:|...::..:           
  Fly   394 NLLKINQIIFIIRRLLK--ILDQRKELQSNGCSMMRTYELTAEGDFFNIDLCELLDFCARTRFAR 456

  Fly   360 ---------------------VSLLDKLVQYLLVASQQMSIRKGGTFTLLSDLLTIVFANKEDVM 403
                                 ||....|:...|.:.|::..:.......:.|:      ||||  
  Fly   457 KVQGRADRMEREPRPSENQAPVSTARSLILQRLASEQKLKEKTKSVKRRVEDI------NKED-- 513

  Fly   404 SKVYASFKVHVLVEESKQGHGKQQGAKQQG-----GWLGKGTIAAATG---LSKVAKIINFWCFN 460
                   |...|.|:.|......:......     .:|...|..|..|   :..|...:.:...:
  Fly   514 -------KAEELQEQQKPTKKPVEEVAPSPIRPLLAFLETLTSNAEDGRILVDPVGGTLKYILLD 571

  Fly   461 PGFGMEQLLN--TQVRSVILTSGTLAPLKPLIAELAIPVAQHLEN---PHIVDQSQVYVKIIGTG 520
            |.   ||..:  .:.|::::..||:.|.|.|..:|.......|..   .|:|....:...:|..|
  Fly   572 PA---EQFADIVAEARAIVIAGGTMQPTKELKEQLFTGCHDRLVERFYNHVVANDAILPFVISNG 633

  Fly   521 PDRQQLISNYANRDNPKYISSLGQTILNVARIVPDGLLVFFPSYPMLNKCVDAWQASGLWADISC 585
            |....|...:|:|.:.:.:..|...:.|:.::||.|::.|.|||..|:|.....:.||....||.
  Fly   634 PSGAPLSFKFAHRGSAEMLRELSMILRNLCQVVPGGVVCFLPSYEYLDKVYKYLEQSGTLETISG 698

  Fly   586 KKPIFLE-PRSKDQFTSTMEEFYQAIR--DSKGAVFMAVCRGKVSEGLDFADRNGRAVIITGLPF 647
            :|.:|.| ..|.:|.   ::.:..||:  .|.||:.::|..||:||||:|||..||||::.|||:
  Fly   699 RKSVFREVSGSAEQL---LDNYALAIKRPASYGALLLSVVGGKLSEGLNFADDLGRAVLVVGLPY 760

  Fly   648 PPLKDPKVILKRRYLEANRTRENQLL---SGQEWYNLDATRAVNQAIGRVIRHRNDYGAILLCDS 709
            .....|::..:.::|:       :.|   :|.|:|.....:||||.|||.:||..||..:.|.|.
  Fly   761 SNSLSPELRQRMQHLD-------EKLGPGAGNEYYENLCVKAVNQCIGRAVRHIKDYACVYLLDK 818

  Fly   710 RFKDASQVQQLSKWIRGHLGDRPQCS-PFGPIVRELRQFFK 749
            ||.|.....:|.|||..|:.:....: .||.:.....:|||
  Fly   819 RFADPKIRGKLPKWISRHIVEANAANGGFGAVQGRTARFFK 859

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4078NP_001259262.1 rad3 10..742 CDD:273169 219/878 (25%)
DEAD_2 111..274 CDD:284209 62/183 (34%)
Helicase_C_2 546..725 CDD:290046 67/185 (36%)
HN_RTEL1 896..985 CDD:259826
CG11403NP_569898.1 DinG 15..841 CDD:224120 217/867 (25%)
DEXDc2 16..394 CDD:214693 101/390 (26%)
Helicase_C_2 659..836 CDD:290046 67/187 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C58194414
eggNOG 1 0.900 E1_COG1199
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D141017at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11472
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.