| Sequence 1: | NP_572251.1 | Gene: | CG15773 / 31494 | FlyBaseID: | FBgn0029795 | Length: | 478 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001033963.1 | Gene: | CG34040 / 3885655 | FlyBaseID: | FBgn0054040 | Length: | 281 | Species: | Drosophila melanogaster |
| Alignment Length: | 222 | Identity: | 56/222 - (25%) |
|---|---|---|---|
| Similarity: | 86/222 - (38%) | Gaps: | 40/222 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 17 LGGLIIMGLAIVDSLECYACDSAEDSECATRPGQQLEVEECQQTGDECVTSISAGLTR-RGCLAR 80
Fly 81 LYPN--GYC-------AAPCDRCNTSLCNRHVYPADRLRCYQCSGSDCIDVASRPQYL--LPCPV 134
Fly 135 YQED-DRCYTNVVHLSNTLRGCEHTNLPTTCPHVCLKCNYN-GCNAEKTVTELRCLQCTHNRLAP 197
Fly 198 NPDCLRDQDPPAAVAEDQPKCSLSNST 224 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15773 | NP_572251.1 | DUF753 | 36..155 | CDD:283175 | 35/131 (27%) |
| DUF753 | 287..438 | CDD:283175 | |||
| CG34040 | NP_001033963.1 | DUF753 | 25..173 | CDD:283175 | 42/161 (26%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45455215 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR21721 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.940 | |||||