DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15773 and CG15170

DIOPT Version :8

Sequence 1:NP_572251.1 Gene:CG15773 / 31494 FlyBaseID:FBgn0029795 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_609927.1 Gene:CG15170 / 35160 FlyBaseID:FBgn0032733 Length:561 Species:Drosophila melanogaster

Alignment Length:458 Identity:144/459 (31%)
Similarity:199/459 (43%) Gaps:71/459 (15%)


  Fly    20 LIIMGLAIVDS-----LECYACDSAEDSECATRPGQ--QLEVEECQQTGDECVTSISAGLTRRGC 77
            |:::.|.::.|     :.||.|||....||:...|:  .|..:|| .|...|..||...:|.|||
  Fly    15 LLLLFLVLLRSDRCFGIVCYHCDSIALPECSQTLGEVGVLPYKEC-ATELTCAMSIVDSITYRGC 78

  Fly    78 LARLYPNGYCAAPCDRCNTSLCNRHVYPADRLRCYQCSGSDCIDV-ASRPQYLLPCPVYQEDDRC 141
            .|.....|  |.....|:|:|||..|||..||:|:.|:|.:|:.. ||:|:   ||..:.|:|:|
  Fly    79 GAETPIIG--ATYSKTCSTNLCNAGVYPPGRLKCHHCAGQECVAAPASKPK---PCRYHLEEDQC 138

  Fly   142 YTNVVHLSNTLRGC----EHTNLPTTCPHVCLKCNYNGCNAEKTVTELRCLQCTHNRLAPNPDCL 202
            ||:|:..|:..|||    .|| |.|:..    .|..||||.|:......|..|..   |....|.
  Fly   139 YTDVISSSDAYRGCTSEQNHT-LSTSAQ----LCEINGCNEEQGAWTQVCATCDS---AIGRGCK 195

  Fly   203 RDQDPPAAVAEDQPKCSLSNSTVTHCVNKVMYGHREN--CFSYRNTQTEVLQRGCSTAMGFYPTG 265
            .|     ....:..:|::  |....|...|:.|.:|:  |||:|.....|  |||||.:   ||.
  Fly   196 ID-----LFQVNTGRCNV--SLYEECQQDVLLGEQEDKYCFSFRRLSRVV--RGCSTKI---PTD 248

  Fly   266 ------ELTECH-GEFCNADC-QDIVCAACNSTANPGCRAG-RNLPTEKC-AAGTTACYSCEQDT 320
                  :|.:|: .:.|||.| ....|..|||.....||.. ..:....| :|..::|:|||.. 
  Fly   249 LEPYVEQLEKCNTSDHCNAGCITQQKCFTCNSVDQELCRTNITAIANSTCSSAEASSCFSCEYS- 312

  Fly   321 LVTHFPFIIPNTFLRRGCADADFAPAALGESCQLCRDADGCNRYSVRSCYRCNAQDQDSDCAAMD 385
                      |..::|||......|..  ..|..|.:..|||......||:|:.....:.||..:
  Fly   313 ----------NWSIQRGCGAPPENPQI--TKCYECDEGAGCNSKDFTRCYQCSTDQAGAGCANWE 365

  Fly   386 LPTTMTTSNCSSPTELCVSTVVSRLDGIYTVRGCEGQVPEC-SANDPYCVRCNGSLCNDA----P 445
            .|..:....|..|...||  ||| .:...|.|||:.....| |||...|..|.||.||..    .
  Fly   366 SPGEIYIEECDEPAAPCV--VVS-FNNATTARGCQKSDFSCASANVASCRLCEGSFCNKGSFPEE 427

  Fly   446 TLW 448
            .||
  Fly   428 RLW 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15773NP_572251.1 DUF753 36..155 CDD:283175 48/122 (39%)
DUF753 287..438 CDD:283175 44/154 (29%)
CG15170NP_609927.1 DUF753 35..166 CDD:283175 53/142 (37%)
DUF753 278..416 CDD:283175 44/154 (29%)
DUF753 351..506 CDD:283175 27/84 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131028219
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21721
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.