DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32758 and myo18a

DIOPT Version :8

Sequence 1:NP_727023.1 Gene:CG32758 / 31493 FlyBaseID:FBgn0052758 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001016030.1 Gene:myo18a / 548784 XenbaseID:XB-GENE-1013112 Length:347 Species:Xenopus tropicalis

Alignment Length:143 Identity:39/144 (27%)
Similarity:65/144 (45%) Gaps:39/144 (27%)


  Fly     3 IVGENHP----LPTPTPASAVVTASSGGGGGGAVVMGVGVGVTTANGPRVVTIYKTETG-FGFNV 62
            :||:..|    ||:..|..|.|                         ||.:.:.:..|| |||::
 Frog   201 VVGKAFPADLRLPSVLPPLAPV-------------------------PRELELQRRNTGDFGFSL 240

  Fly    63 RGQVSEGGQLRSINGELYAPLQHVSAVLENGAAEK---AGIKKGDRILEVNGVSVEGATHKQVVD 124
            |......   |:.:|::|..:.|.:   |.||..|   .|:..|||::|:||.:||..:..::|:
 Frog   241 RRTTMLD---RAPDGQVYRRVVHFA---EPGAGTKDLALGLVPGDRLVEINGRNVENKSRDEIVE 299

  Fly   125 LIKSGGDCLTLTV 137
            :|:..||.:.|.|
 Frog   300 MIRQSGDTVRLKV 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32758NP_727023.1 PDZ_signaling 46..138 CDD:238492 31/97 (32%)
PX_SNX27 165..270 CDD:132796
UBQ 278..363 CDD:294102
FERM-like_C_SNX27 428..528 CDD:270146
myo18aNP_001016030.1 PDZ_signaling 223..313 CDD:238492 31/97 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001589
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.