DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32758 and snx-13

DIOPT Version :8

Sequence 1:NP_727023.1 Gene:CG32758 / 31493 FlyBaseID:FBgn0052758 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_503026.3 Gene:snx-13 / 178482 WormBaseID:WBGene00013803 Length:940 Species:Caenorhabditis elegans

Alignment Length:495 Identity:96/496 (19%)
Similarity:171/496 (34%) Gaps:176/496 (35%)


  Fly    42 TANGPRVVTIYKTETGFGFNVRGQVSEGGQLRSIN-GELYAPLQHVSAVLENGAAEKAGIKKGDR 105
            :|.|...:.:|....||      :||...|:||:: |||          .|:.|.|.  :|:..:
 Worm   396 SAGGQNYIDLYLAIEGF------KVSVEHQMRSLSKGEL----------SESDAYET--VKEAAK 442

  Fly   106 ILEVNGVSVEGAT-----------------------------HKQVVDLI-----------KSGG 130
            .:....:|.|..|                             .::|::::           ||.|
 Worm   443 YMYDQYLSEEAITRVPLEDALISRFLQSLKNDEPHDLWFESIQEKVIEVLKTDDHFFPAFKKSAG 507

  Fly   131 ---------------------DCLTLTVISVTQQEADRLEPQEDQSGYSYID--YSDKRSLPISI 172
                                 :|.::|..|.:|..::..|....:.....:|  ..|:..:..::
 Worm   508 YVKMLLELEIIDEDRNDPTLSECDSVTSFSSSQDRSEDCESALRKMSIEVVDGPLEDEPVMTATV 572

  Fly   173 PDYGIVNRNGERYIVFNIHMA----GRQLCS----RRYREFANLHSLLRKEFSGFNFPKLPGKWP 229
            ...||.::..:.|.::|:.::    ||::.|    |||.:|..||.:|.::|...:....|||..
 Worm   573 ETLGIGHQGKQTYALYNVRVSRCVNGREVSSWNVIRRYSDFHTLHQVLVQKFPKLSTLSFPGKKT 637

  Fly   230 F-QLSEQQLDTRRRGLEQYLEKVC---AVRVIAESDA-VQDFLTDTEDDISASPVDIKVM----- 284
            | .|..:.|:.|.:.|..||..:.   .:|...|.|. |.|||:. :...:::|:..|.|     
 Worm   638 FNNLDNEFLEKRTKALNMYLSCILQPHLLRNYPEMDRHVFDFLSQ-KKYANSNPLTKKFMSAMFD 701

  Fly   285 ---------------LPD-------------HEVSTVSVKKSSNAQV----VWEILVQRANLTAY 317
                           :||             :..:.:.:..||::.|    |.|.....|:||  
 Worm   702 PIRNGVKAVGTTVMAVPDQVFEGVTKMGVGINNAAKIIINPSSSSTVNRPPVMETDRVAASLT-- 764

  Fly   318 TQQYFYLFEIVEYNFERKLQPHEIPHQLYV----QNYSTASSTCLCVRRWLFSVAKELTLPDGEQ 378
                             ..:...||.::.|    :.:....|...  ||.|.:|.|.:..|.|..
 Worm   765 -----------------DTESENIPLRVLVLVVSEVFGAQGSAWF--RRQLVTVIKHIVTPFGTS 810

  Fly   379 AGRFIFYQAVDEVNRGNIRADGRLYELKALQDAKKAGDYL 418
            ..:.|    ||.||              .|...::.|.||
 Worm   811 INKRI----VDIVN--------------WLTSEQQVGGYL 832

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32758NP_727023.1 PDZ_signaling 46..138 CDD:238492 24/154 (16%)
PX_SNX27 165..270 CDD:132796 32/118 (27%)
UBQ 278..363 CDD:294102 19/126 (15%)
FERM-like_C_SNX27 428..528 CDD:270146
snx-13NP_503026.3 PXA 95..283 CDD:280373
RGS_SNX13 380..510 CDD:188674 24/132 (18%)
PX_domain 564..683 CDD:295365 33/120 (28%)
Nexin_C 791..899 CDD:285792 16/63 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1370
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.