DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33080 and MYORG

DIOPT Version :8

Sequence 1:NP_788858.1 Gene:CG33080 / 31491 FlyBaseID:FBgn0053080 Length:925 Species:Drosophila melanogaster
Sequence 2:NP_065753.2 Gene:MYORG / 57462 HGNCID:19918 Length:714 Species:Homo sapiens

Alignment Length:758 Identity:198/759 (26%)
Similarity:325/759 (43%) Gaps:123/759 (16%)


  Fly   229 REKMQAFPQLIR----------------------------KKKRETKDYK--IKIFVIIMFFIII 263
            :||.||:|:..|                            .|.:.:||.|  :...|:.:..::.
Human     6 QEKSQAYPRRRRPGCYAYRQNPEAIAAAAMYTFLPDNFSPAKPKPSKDLKPLLGSAVLGLLLVLA 70

  Fly   264 FLIGYAYVAYHQQVLTRSYFQ---------KIKFNSHDRIFRILSHE---DKEVIS---GQLGVT 313
            .::.:.|.:...:...|...:         .|:....:::||:....   |.:..|   ..||.:
Human    71 AVVAWCYYSVSLRKAERLRAELLDLKAGGFSIRNQKGEQVFRLAFRSGALDLDSCSRDGALLGCS 135

  Fly   314 LGFDTAPFHCLEEQRRSDGSVCIEWNGVARLHLNFEDKGVFRCYTLQWQALTPGLLPTDCYELKR 378
            |..|..|.|...:..|                    .|....||.::|:...||........|..
Human   136 LTADGLPLHFFIQTVR--------------------PKDTVMCYRVRWEEAAPGRAVEHAMFLGD 180

  Fly   379 DNGLWFGGGVTKGQEWSLSY-ANFDFAPYASGD--SKIHQFGNGVKRYFINSIGVAMQVSEKTPL 440
            ....|:||...:.|.|.:.. ...:..|:.:.|  |....||..::||:::|...|::|::..|.
Human   181 AAAHWYGGAEMRTQHWPIRLDGQQEPQPFVTSDVYSSDAAFGGILERYWLSSRAAAIKVNDSVPF 245

  Fly   441 QLGVNRTENRFCLRAANDEFTFVNHLTP---------LPQLDYRICTTEDMRSLHMLMTQQSLWD 496
            .||.|.||....|:|.       .|.||         .|:|.||:|...|:.|:|..|.::..  
Human   246 HLGWNSTERSLRLQAR-------YHDTPYKPPAGRAAAPELSYRVCVGSDVTSIHKYMVRRYF-- 301

  Fly   497 GLKEQEFKV-LHSLLEEPVW--------RIPHTELPESLNESAICDYSESAIAMGLGHIVINEFW 552
               .:..:| ......:|:|        .:...::.....:..:..::.|       |:.|::.:
Human   302 ---NKPSRVPAPEAFRDPIWSTWALYGRAVDQDKVLRFAQQIRLHHFNSS-------HLEIDDMY 356

  Fly   553 QENIGDFTVDKARFPTLKDTIDVLHRRGFKVVLTIQPFISTDSANFKDAVKRKLLIYERHSERSI 617
            ....|||..|:.:||...|....|...||:|.|.:.||::.:|:.|.:.|:|:|.:  |.....:
Human   357 TPAYGDFDFDEVKFPNASDMFRRLRDAGFRVTLWVHPFVNYNSSRFGEGVERELFV--REPTGRL 419

  Fly   618 PALTRYKSSSSAGVLDITNNASVPWLLEKLQRLKEEYGVQSFYLDLGTGYNLPHYYQCRQTLDNP 682
            |||.|:.:...| |||.|:..:..|....|:||:..|.|.||..|.|....||..:...:.|.:|
Human   420 PALVRWWNGIGA-VLDFTHPKARDWFQGHLRRLRSRYSVASFKFDAGEVSYLPRDFSTYRPLPDP 483

  Fly   683 DTYARLFT-ASLEGAGLMAVSTASVVPKPPTFLSTPPANATWE---GLRETLGAVLNYGVIGYPF 743
            ..::|.:| .:|....|..|...........|......::.|.   |||..:.|||...::||||
Human   484 SVWSRRYTEMALPFFSLAEVRVGYQSQNISCFFRLVDRDSVWGYDLGLRSLIPAVLTVSMLGYPF 548

  Fly   744 VLPGVIGGDYLLQRPLSKMVSFYSLSQPPLPDPELFIRWLQLATFMPAMQFSHLPSEYRSDLVTR 808
            :||.::||:.:.||.....|          |:.||:||||::|.||||||||..|..|.:::|. 
Human   549 ILPDMVGGNAVPQRTAGGDV----------PERELYIRWLEVAAFMPAMQFSIPPWRYDAEVVA- 602

  Fly   809 VAQELKEVRQLIVIPLLKKYLNPSMNEGLPLVRPLWMMDPHDPACLIVSDEFSVGEELIVAPILH 873
            :||:...:|..:|.|||.:......:.|.|:|||||.:.|.|.....:..:|.:|:.|:|||:|.
Human   603 IAQKFAALRASLVAPLLLELAGEVTDTGDPIVRPLWWIAPGDETAHRIDSQFLIGDTLLVAPVLE 667

  Fly   874 ANREEREVYLPQGVWKDGIDGSLRKGSRWMHGYRVPKDKIAYF 916
            ..::||:||||.|.|:........|....:..|.|..|:||||
Human   668 PGKQERDVYLPAGKWRSYKGELFDKTPVLLTDYPVDLDEIAYF 710

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33080NP_788858.1 GH31_NET37 511..888 CDD:269878 121/389 (31%)
MYORGNP_065753.2 GH31_NET37 314..682 CDD:269878 121/389 (31%)
Glyco_hydro_31 329..707 CDD:279404 124/399 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5596
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D238940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130818
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.