DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33080 and ganab

DIOPT Version :8

Sequence 1:NP_788858.1 Gene:CG33080 / 31491 FlyBaseID:FBgn0053080 Length:925 Species:Drosophila melanogaster
Sequence 2:XP_004919758.1 Gene:ganab / 100492576 XenbaseID:XB-GENE-997256 Length:979 Species:Xenopus tropicalis

Alignment Length:658 Identity:128/659 (19%)
Similarity:214/659 (32%) Gaps:229/659 (35%)


  Fly   381 GLWF-----------GGGVTKGQEWSL-SYANFDFAPYASGDSKIHQFGNGVKRYFINSIGV--- 430
            |:|.           .|..:.|.::|| .:.|....|..:.:.|: :...|...|.:.::.|   
 Frog   260 GMWDETFKTHTDSKPNGPSSVGLDFSLPGFENVYGIPEHADNMKL-RTTEGTDPYRLYNLDVFQY 323

  Fly   431 ----AMQVSEKTPLQL--GVNRTENRFCLRAANDEFTFVNHLTPL-------------------P 470
                .|.:....||.|  .|.||...|.|.||.   |:|:..:.:                   |
 Frog   324 DLYNTMALYGSVPLLLAHNVKRTLGIFWLNAAE---TWVDISSNIAGKTLLGKMLQYMQGGGETP 385

  Fly   471 QLDYRICTTEDMRSLHMLM----------------TQ-----------QSLWDGLKEQEFKVL-- 506
            |.|.|..:...:..:.:|:                ||           |..|:...|::.:.:  
 Frog   386 QTDVRWMSESGIIDVFLLLGPSPFDVFKQYASLTGTQALPPYFSLGYHQCRWNYNDEEDVRNVDA 450

  Fly   507 ----HSLLEEPVW-RIPHTELPESLNESAICDYSESAIAMGLGHIVINEFWQENIGDFTVDKARF 566
                |.|..:.:| .|.|.:                    |..:             ||.|..:|
 Frog   451 GFDEHDLPYDVIWLDIEHAD--------------------GKRY-------------FTWDPHKF 482

  Fly   567 PTLKDTIDVLHRRGFKVVLTIQPFISTDSANFKDAVKRKLLIYERHSE-RSIPALTRYKSSS--- 627
            |..:|.:..|..:..|:|..:.|.|..||.            |..|:: ||.....:.|..|   
 Frog   483 PNPRDMLSGLKNKRRKMVAIVDPHIKIDSG------------YRIHNDIRSQNLYIKTKDGSDYE 535

  Fly   628 ------SAGVLDITNNASVPWLLEKLQRLKEEYGVQSFYL--DLGTG------------------ 666
                  ||...|.||.....|........|.|..:.:.::  |:...                  
 Frog   536 GWCWPGSAAYPDFTNPEMRKWWASMFAYDKYEGSMDNLFVWNDMNEPSVFNGPEVTMHKDAVHWG 600

  Fly   667 -------YNLPHYYQCRQT----------LDNPDTYARLFTASLEGAGLMAVSTASVVPKPPTFL 714
                   :||..:|..|.|          .:.|....|.|.|..:..|  ||.|....       
 Frog   601 GWEHRDVHNLYGFYVQRATSEGLIQRSGGKERPFVLTRAFFAGSQRYG--AVWTGDNA------- 656

  Fly   715 STPPANATWEGLRETLGAVLNYGVIGYPFVLPGV-IGGDYLLQRPLSKMVSFYSLSQPPLPDPEL 778
                  |.|:.|:.::...|:..::|..|.  |. :||             |:.     .||.||
 Frog   657 ------AEWDHLKISIPMCLSLSLVGISFC--GADVGG-------------FFK-----NPDAEL 695

  Fly   779 FIRWLQLATFMPAMQ-FSHLPSEYR------SDLVTRVAQELKEVRQLIVIPLLKKYLNPSMNEG 836
            .:||.|...:.|..: .:||.:..|      .|.:..:.:.|::  :..::|........::.||
 Frog   696 LVRWYQAGAYQPFFRAHAHLDTPRREPWLHGDDNMAVIREALRQ--RYTLLPFWYTLFYRALREG 758

  Fly   837 LPLVRPLWMMDPHDPACLIVSDEFSVGEELIVAPILHANREEREVYLPQG--VWKDGIDGSLRKG 899
            .|::||||:..|.|.:...:...:.:|..|:|.|:..|.....::|||..  ||.|         
 Frog   759 EPVMRPLWVEFPSDASTFAMDSHYMLGSALLVRPVTEAKARGVQIYLPGDGEVWYD--------- 814

  Fly   900 SRWMHGYR 907
               :|.|:
 Frog   815 ---VHSYQ 819

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33080NP_788858.1 GH31_NET37 511..888 CDD:269878 87/435 (20%)
ganabXP_004919758.1 GH31_N 280..420 CDD:270212 27/144 (19%)
Glyco_hydro_31 401..846 CDD:279404 99/514 (19%)
GH31_GANC_GANAB_alpha 420..887 CDD:269889 98/495 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.