DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33080 and mgam

DIOPT Version :8

Sequence 1:NP_788858.1 Gene:CG33080 / 31491 FlyBaseID:FBgn0053080 Length:925 Species:Drosophila melanogaster
Sequence 2:XP_012818885.1 Gene:mgam / 100379714 XenbaseID:XB-GENE-964595 Length:2697 Species:Xenopus tropicalis

Alignment Length:714 Identity:144/715 (20%)
Similarity:246/715 (34%) Gaps:211/715 (30%)


  Fly   337 EWNGVARLHLNFEDKGVFRCYTLQ----------WQALTPGLLPTD-----CYELKRDNGLWFGG 386
            |:.|.|..:||::.|.:.:.:.:|          :.:....||..|     ..:|...|....|.
 Frog   166 EFTGSAASNLNYDYKLLDKPFGIQVIRKSNSRILFDSTIGPLLYADQVLQLSIKLPSSNIYGLGE 230

  Fly   387 GV-------TKGQEWSLSYANFDFAPYASGDSKIHQFGN---GVKRYFI-------NSIGVAMQV 434
            .|       |..::|::    |....:.:||      ||   |...:|:       :|.||    
 Frog   231 HVHRQYKHDTYWKKWAI----FTRDEFPNGD------GNNLYGAHTFFLCLEDTDGSSFGV---- 281

  Fly   435 SEKTPLQLGVNRTENRFCLRAANDEFTFVNHLTPLPQLDYRICTTEDMRSLHMLMTQQSLWDGLK 499
                            |.:.:...|.|    :.|.|.:.||  |...:...::.:...      .
 Frog   282 ----------------FLMNSNAMEVT----IQPAPAITYR--TIGGILDFYVFVGNS------P 318

  Fly   500 EQEFKVLHSLLEEP----VW-------RIPHTELPESLNESAICDYSESAIAMGLGHIVINEF-- 551
            ||.......|:..|    .|       |..::.|.|      :....|...|:|:.:.|  :|  
 Frog   319 EQVVMEYLELIGRPYMPAYWTLGFHLSRWGYSSLDE------VKQVVERNRAIGIPYDV--QFTD 375

  Fly   552 --WQENIGDFTVDKARFPTLKDTIDVLHRRGFKVVLTIQPFISTDSANFKDAVKRKLLIYERHSE 614
              :.|...|||.||.:|..|....:.||..|.:.::.:.|.|:.     ...:....|.|||.:.
 Frog   376 IDYMEEKKDFTYDKVKFKDLPSFAEDLHAHGQRYIIILDPAIAN-----TPLIDGPYLAYERGTN 435

  Fly   615 RSI----------------PALTRYKSSSSAGVLDITNNASVPWLLEKLQRLKEEYGVQSFYLDL 663
            ..:                |..|.|.        |.||.|...|.:::.....::......::|:
 Frog   436 LGVWVNESDGVTPLVGKVWPGDTVYP--------DYTNEACTKWWVQECLEFYKQVPYDGIWIDM 492

  Fly   664 ------------GTGYNLPHYYQCRQTLDNPDTYARLFTASLEGA-GL-----------MAVST- 703
                        |...|..:|......:.:...|::......:.| ||           ||:|| 
 Frog   493 NEVSNFVRGSNKGCASNKLNYPPYTPRIKDNVMYSKTLCMDAKQAWGLHYDVHNLYGYSMALSTE 557

  Fly   704 ----------ASVVPKPPTFLSTPPAN--------ATWEGLRETLGAVLNYGVIGYPFVLPGVIG 750
                      .|::....||......:        |.|..::..:..:..:.:.|.|:     ||
 Frog   558 EAIKAVFPGKRSIIFSRSTFAGAGKYSGHWLGDNAANWNDIKWAIPGMFEFSLFGIPY-----IG 617

  Fly   751 GDYLLQRPLSKMVSFYSLSQPPLPDPELFIRWLQLATFMP------AMQFSHL-PSEYRSD-LVT 807
            .|         :..|:..|     ..||..||:|:..|.|      |..|.|. |:.|.:| |:.
 Frog   618 AD---------ICGFFDDS-----SEELCRRWMQVGAFYPFSRNHNAETFKHQDPASYGADSLLV 668

  Fly   808 RVAQELKEVRQLIVIPLLKKYLNPSMNEGLPLVRPLWMMDPHDPACLIVSDEFSVGEELIVAPIL 872
            :.::....:|..: :|.|......:..:|..:||||......||....:.::|..|..|::.|||
 Frog   669 KTSRHYLNIRYTL-LPYLYTLFYKAHTKGETVVRPLLHEFYSDPETWGIDNQFLWGPGLLITPIL 732

  Fly   873 HANREEREVYLPQGVW---KDGIDGSLRKGSRWMHGYRVPKDKIA--------YFRKMPDNTRF 925
            :.|.....||:|...|   :.|...|.||.:..|:   :|:|||.        :..:.|.||.|
 Frog   733 NPNSVNAYVYIPDAKWYNYETGTQASWRKQNVDMY---IPEDKIGLHVRGGYIFPTQQPANTTF 793

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33080NP_788858.1 GH31_NET37 511..888 CDD:269878 93/459 (20%)
mgamXP_012818885.1 Trefoil 58..95 CDD:278515
NtCtMGAM_N 112..221 CDD:293468 11/55 (20%)
GH31_N 214..330 CDD:270212 27/158 (17%)
Glyco_hydro_31 311..782 CDD:279404 106/521 (20%)
GH31_MGAM_SI_GAA 330..693 CDD:269888 76/404 (19%)
Trefoil 915..960 CDD:238059
NtCtMGAM_N 989..1090 CDD:293468
GH31_N 1083..1197 CDD:270212
Glyco_hydro_31 1178..1673 CDD:279404
GH31_MGAM_SI_GAA 1197..1568 CDD:269888
Trefoil <1813..1848 CDD:238059
NtCtMGAM_N 1864..1977 CDD:293468
GH31_N 1963..2084 CDD:270212
Glyco_hydro_31 2065..2560 CDD:279404
GH31_MGAM_SI_GAA 2084..2470 CDD:269888
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.