DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3149 and RFT1

DIOPT Version :8

Sequence 1:NP_572246.1 Gene:CG3149 / 31489 FlyBaseID:FBgn0027564 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_009533.1 Gene:RFT1 / 852261 SGDID:S000000116 Length:574 Species:Saccharomyces cerevisiae

Alignment Length:606 Identity:142/607 (23%)
Similarity:242/607 (40%) Gaps:164/607 (27%)


  Fly     2 ARNVLESSLLGAGFSIIFQILCRILTFGINAYIVRHVGREVLGIMNVRLLLLESTLLFLSREAIN 66
            :..:||.|..||.|.::.|:..:::||.:|..::|.:...:.|| ...|..::.|:||.||:||.
Yeast    12 SEQILERSTTGATFLMMGQLFTKLVTFILNNLLIRFLSPRIFGI-TAFLEFIQGTVLFFSRDAIR 75

  Fly    67 RAAL----SANA-------QQGDRCSWAQLINQ---------MWLTVPICAVLCA---------- 101
            .:.|    |.|.       ::.....:...:.|         .|:..|:...|.|          
Yeast    76 LSTLRISDSGNGIIDDDDEEEYQETHYKSKVLQTAVNFAYIPFWIGFPLSIGLIAWQYRNINAYF 140

  Fly   102 ---PCL--YIWLNWLSAVDAI--------------YASQYEFACYAVAFSCVLELMAESAVFVAQ 147
               |..  .|:|.|||.:..:              ||::..|...||...|::..:   .|:..|
Yeast   141 ITLPFFRWSIFLIWLSIIVELLSEPFFIVNQFMLNYAARSRFESIAVTTGCIVNFI---VVYAVQ 202

  Fly   148 VFCFVKLKILLNTLHILVRSAIFLWIVTGD---RSAAINAFAIAQLSSAVTIVLGQYGFFYFYLK 209
                              :|...:.:||.|   ...||.|||:.:|:.::|::.   .:::.|||
Yeast   203 ------------------QSRYPMGVVTSDIDKEGIAILAFALGKLAHSITLLA---CYYWDYLK 246

  Fly   210 GFKDFVTQQAKKKPVAPKAWQVSLYEHMD---DFPFKQLSDFLPGVMFNPNGKHFNRELQTLTLS 271
            .||       .||..:.:..::...|:.:   .:| |..|.|..    |...:||.:....|   
Yeast   247 NFK-------PKKLFSTRLTKIKTRENNELKKGYP-KSTSYFFQ----NDILQHFKKVYFQL--- 296

  Fly   272 FVKQGVLKQILTEGEKYVMSVSPVLSFGEQATYDVVNNLGSMAARFIFRPIEDSSYFYFTQTLS- 335
                 ..|.:||||:|.:  ::.:.:..||..|.:::|.||:..|.:|.|||:|...:..:.|| 
Yeast   297 -----CFKHLLTEGDKLI--INSLCTVEEQGIYALLSNYGSLLTRLLFAPIEESLRLFLARLLSS 354

  Fly   336 ---RDIKLAKQPQERVRQASSVLNNLLLGVSSIGLIAFTFGQSYSYPVLLLYGGPDFVAGGLPQS 397
               :::||:.:          ||.||......:.|:...||.:.|..:|      .|:.|.    
Yeast   355 HNPKNLKLSIE----------VLVNLTRFYIYLSLMIIVFGPANSSFLL------QFLIGS---- 399

  Fly   398 LLQW-----------HCLAIYLLAVNGISEGYMFATNTSRDIDKYNYLMAIFSVSFLVLSYILTG 451
              :|           :|..|..|::|||.|.:..:..|...|.|::|.|..||..||:.|::|..
Yeast   400 --KWSTTSVLDTIRVYCFYIPFLSLNGIFEAFFQSVATGDQILKHSYFMMAFSGIFLLNSWLLIE 462

  Fly   452 --IFGPVGFIFANCINMLSRILYSTYYIRHQYRPLSLDPLLGLWPGKLFGCTLFLAGIVCYWYQS 514
              .....|.|.:|.|||:.||||...::...:|.|..|.                    .:::..
Yeast   463 KLKLSIEGLILSNIINMVLRILYCGVFLNKFHRELFTDS--------------------SFFFNF 507

  Fly   515 SDLATHLGVGVLAGLACLLSW 535
            .|..|   |.:.....|||.|
Yeast   508 KDFKT---VIIAGSTICLLDW 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3149NP_572246.1 Rft-1 8..547 CDD:282375 140/601 (23%)
RFT1NP_009533.1 Rft-1 18..563 CDD:309588 140/601 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C221091406
eggNOG 1 0.900 E1_KOG2864
Hieranoid 1 1.000
Homologene 1 1.000 H5343
Inparanoid 1 1.050 109 1.000 Inparanoid score I1377
Isobase 1 0.950 0 Normalized mean entropy S3683
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003801
OrthoInspector 1 1.000 T1136991
orthoMCL 1 0.900 OOG5_129166
Panther 1 1.100 LDO PTHR13117
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1092
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.