DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3149 and AT5G07630

DIOPT Version :8

Sequence 1:NP_572246.1 Gene:CG3149 / 31489 FlyBaseID:FBgn0027564 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_196380.5 Gene:AT5G07630 / 830656 AraportID:AT5G07630 Length:611 Species:Arabidopsis thaliana

Alignment Length:561 Identity:163/562 (29%)
Similarity:267/562 (48%) Gaps:85/562 (15%)


  Fly    15 FSIIFQILCRILTFGINAYIVRHVGREVLGIMNVRLLLLESTLLFLSREAINRAALSANAQQG-- 77
            ||:..|.:.|.:.|..|::||||:......:..::..|..:.:||||||...||.|.|..::.  
plant   106 FSLSRQFISRSIPFVFNSWIVRHLTERDYALYAIQFHLFVTCVLFLSREGFRRACLRAGTKRDGP 170

  Fly    78 -DRCSWAQLINQMWLTVPI-CAVLCAPCLYI-WLNWLSAVDAIYASQYEFACYAVAFSCVLELMA 139
             ...:..:::...|:|||: .|:..|.|::: |...||     |:..|..|.:...|:|||||||
plant   171 ESEENVTRILKVAWVTVPLGIAITIAACIFVLWWQNLS-----YSDPYAQAIWIHGFACVLELMA 230

  Fly   140 ESAVFVAQVFCFVKLKILLNTLHILVRS-AIFLWIVTGDRSAAINAFAIAQLSSAVTIVLGQYGF 203
            |....::|....::|::::.|:..|.|. .::..:|.......:..||::|::...::.:|.:. 
plant   231 EPLYILSQTLLKLQLRLIVETVATLARCVTLYSLLVMQTNMEKVIIFALSQVAYGGSLFIGYWA- 294

  Fly   204 FYFYLKGFKDFVTQQAKKKPVAPKAWQVSLYEHMDDFPFKQLSDFLPGVMFNPNGKHFNRELQTL 268
             ||.:.|                      :|...:.|||:      ||     |...|:.:|..:
plant   295 -YFLICG----------------------VYRSSNLFPFR------PG-----NFMDFDNDLSKM 325

  Fly   269 TLSFVKQGVLKQILTEGEKYVM--SVSPVLSFGEQATYDVVNNLGSMAARFIFRPIEDSSYFYFT 331
            ...|..|...|.||.||||.|:  ..:|.    .||.|.:|:.|||:..|.:|.|.|:|||..|.
plant   326 CKLFTFQSFRKLILQEGEKLVLVWLDTPY----NQAVYGIVDKLGSLVVRMVFLPFEESSYTIFA 386

  Fly   332 QTLSRDIKLAKQPQERVRQASSVLNNLLLGVSSIGLIAFTFGQSYSYPVL-LLYGGPDFVAGGLP 395
            :..|.|.      |||.::....|...|..|..||||...||.||||.:: ||||  :..:.|..
plant   387 RFASGDY------QERNKKLGIYLTVALKLVILIGLIFMAFGPSYSYSLIRLLYG--EKWSDGEA 443

  Fly   396 QSLLQWHCLAIYLLAVNGISEGYMFATNTSRDIDKYNYLMAIFSVSFLVLSYILTGIFGPVGFIF 460
            ...||::||.|.:||:||.||.::.|..|..::::.|.::.|||:.::.|:.:|....|.:|.|.
plant   444 SLALQFYCLYIIVLAMNGTSEAFLHAVGTKNELERSNDMLLIFSLIYVALNILLIRSAGAIGLIM 508

  Fly   461 ANCINMLSRILYSTYYIRHQYRPLSLDPLLGLWPGKLFGCTLFLAGIVC------------YWYQ 513
            ||.:||:.||:||..:|:..::..|.......:|  |....|.|:.|:.            :|  
plant   509 ANSLNMIFRIIYSGRFIQRYFQGTSSFSFRKCFP--LGWQILILSSIITLISEKTILDRKNFW-- 569

  Fly   514 SSDLATHLGVGVLAGLACLLSWALAHRDLVRLAWRYGRRIK 554
             .....|.|:||:.  .||.:..:..|:.|     :.:|||
plant   570 -ETFPLHFGIGVIC--FCLSAIVIYRRERV-----FIKRIK 602

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3149NP_572246.1 Rft-1 8..547 CDD:282375 160/553 (29%)
AT5G07630NP_196380.5 MATE_rft1 99..531 CDD:240535 145/477 (30%)
RfbX 100..605 CDD:225153 163/562 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H5343
Inparanoid 1 1.050 195 1.000 Inparanoid score I1314
OMA 1 1.010
OrthoDB 1 1.010 D582756at2759
OrthoInspector 1 1.000 T193038
orthoMCL 1 0.900 OOG5_129166
Panther 1 1.100 LDO PTHR13117
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.