DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3149 and rft1

DIOPT Version :8

Sequence 1:NP_572246.1 Gene:CG3149 / 31489 FlyBaseID:FBgn0027564 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001072828.1 Gene:rft1 / 780289 XenbaseID:XB-GENE-1015143 Length:539 Species:Xenopus tropicalis

Alignment Length:569 Identity:216/570 (38%)
Similarity:315/570 (55%) Gaps:52/570 (9%)


  Fly     2 ARNVLESSLLGAGFSIIFQILCRILTFGINAYIVRHVGREVLGIMNVRLLLLESTLLFLSREAIN 66
            ::.||..:...|.:|:|.|||.|:|||.:||:.:|:|.:|::||:||||.|..:|::||:|||..
 Frog     3 SQEVLMDATKLASYSVILQILFRVLTFALNAFTLRYVSKEIIGIVNVRLTLFYTTVVFLAREAFR 67

  Fly    67 RAALSANAQQGDRCSWAQLINQMWLTVPICAVLCAPCL--YIWLNWLSAVDAIYASQYEFACYAV 129
            ||.||.:|||    ||...|:..||.||:  .:|...:  :|||..|...:......|....:|.
 Frog    68 RACLSHSAQQ----SWRHTIHLTWLAVPL--GICWSFILGWIWLQILEVPEPEAIPYYNIGVWAF 126

  Fly   130 AFSCVLELMAESAVFVAQVFCFVKLKILLNTLHILVRSAIFLWIVTGDRSAAINAFAIAQLSSAV 194
            .||.|:||:||....:||...|||||::..:|.|::|.::.:.:|.......:..|::||:....
 Frog   127 GFSAVVELLAEPFWVLAQAHLFVKLKVVAESLAIIIRCSVTVILVLLCPQWGLLIFSLAQVLYTS 191

  Fly   195 TIVLGQYGFFYFYLKGFKDFVTQQAKKKPVAPKAWQVSLYEHMDDFPFKQLSDFLPGVMFNPNGK 259
            .:.|....:|..:|...      :|:|||                ||.:::.:|||  .|:.:..
 Frog   192 ALALCYIAYFARFLGSL------EAEKKP----------------FPLRRMREFLP--RFSSSQA 232

  Fly   260 HFNRELQTLTLSFVKQGVLKQILTEGEKYVMSVSPVLSFGEQATYDVVNNLGSMAARFIFRPIED 324
            ..:.:...|..||.||..|||||||||:|||:...|||||:|..||:||||||:.|||||.|||:
 Frog   233 FLDWKQAWLAWSFFKQSFLKQILTEGERYVMTFLNVLSFGDQGVYDIVNNLGSLVARFIFLPIEE 297

  Fly   325 SSYFYFTQTLSRDIKLAKQPQERVRQASSVLNNLLLGVSSIGLIAFTFGQSYSYPVLLLYGGPDF 389
            |.|.:|.:.|.|..|:..|.:|.:..||.||.:||..|:.|||:...||.:||:..|.:||| ..
 Frog   298 SFYVFFAKVLERGKKVQSQRKEEISMASEVLESLLKLVTLIGLVIIAFGYAYSHLALDIYGG-SM 361

  Fly   390 VAGGLPQSLLQWHCLAIYLLAVNGISEGYMFATNTSRDIDKYNYLMAIFSVSFLVLSYILTGIFG 454
            ::||....||:.:||.:.|||:||::|.:.||:....|:|:|||:|...|:|||.|||.:|...|
 Frog   362 LSGGSGPVLLRCYCLYVLLLAINGVTECFTFASMGKEDVDRYNYVMLGLSLSFLCLSYYMTLWLG 426

  Fly   455 PVGFIFANCINMLSRILYSTYYIRHQYRPLSLDPLLGLWPGKLFGCTLFLAGIVCYWYQSSDLAT 519
            .||||.|||.||..||.:|..||...|:.....||:||.|..:..|.|.::..|..:   |::|.
 Frog   427 SVGFILANCFNMGLRITHSLLYIMRYYKGSPYQPLIGLLPSPVVVCVLAVSAAVTGY---SEVAL 488

  Fly   520 -----------HLGVG-----VLAGLACLLSWALAHRDLVRLAWRYGRR 552
                       |:.||     |..|.|.|....|.|.....|..|:.|:
 Frog   489 CCDKGWLLCLGHIVVGGLCLLVTLGAAVLSEKKLTHFIRSHLLSRHQRK 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3149NP_572246.1 Rft-1 8..547 CDD:282375 212/557 (38%)
rft1NP_001072828.1 Rft-1 11..527 CDD:282375 211/550 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H5343
Inparanoid 1 1.050 339 1.000 Inparanoid score I2191
OMA 1 1.010
OrthoDB 1 1.010 D338482at33208
OrthoFinder 1 1.000 FOG0003801
OrthoInspector 1 1.000 T1061644
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1092
TreeFam 00.000 Not matched by this tool.
88.100

Return to query results.
Submit another query.