DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3149 and Rft1

DIOPT Version :8

Sequence 1:NP_572246.1 Gene:CG3149 / 31489 FlyBaseID:FBgn0027564 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_808483.2 Gene:Rft1 / 328370 MGIID:3607791 Length:541 Species:Mus musculus

Alignment Length:553 Identity:206/554 (37%)
Similarity:298/554 (54%) Gaps:45/554 (8%)


  Fly     2 ARNVLESSLLGAGFSIIFQILCRILTFGINAYIVRHVGREVLGIMNVRLLLLESTLLFLSREAIN 66
            ::.||..:...|...::.|:|.|::||.:||:|:|.:.:|::||:||||.||.||..||:|||..
Mouse     3 SQEVLGQAARLASSGLLLQVLFRLITFVLNAFILRFLSKEIVGIVNVRLTLLYSTTTFLAREAFR 67

  Fly    67 RAALSANAQQGDRCSWAQLINQMWLTVPICAVLCAPCL-YIWLNWLSAVDAIYASQYEFACYAVA 130
            ||.||..||:    .|:|.:|.:|||||: .:..:.|| ::||..|...|......|........
Mouse    68 RACLSGGAQR----DWSQTLNLLWLTVPL-GIFWSSCLGWVWLQLLEVPDPDVVPYYGTGVLFFG 127

  Fly   131 FSCVLELMAESAVFVAQVFCFVKLKILLNTLHILVRSAIFLWIVTGDRSAAINAFAIAQLSSAVT 195
            .|.|:||:.|....:||...|||||:|..::.:::||.:...:|.......:..|::|||.....
Mouse   128 LSAVVELLGEPFWVLAQAHMFVKLKVLAESMSVILRSVLTALLVLWLPHWGLYIFSLAQLLYTTV 192

  Fly   196 IVLGQYGFFYFYLKGFKDFVTQQAKKKPVAPKAWQVSLYEHMDDFPFKQLSDFLPGVMFNPNGKH 260
            :||    .:..||        .|..:.|.:.|  |::|       |..:::..||.:  :.:...
Mouse   193 LVL----CYAIYL--------IQLLRSPESAK--QLTL-------PVSRVTQLLPSI--SRSRAF 234

  Fly   261 FNRELQTLTLSFVKQGVLKQILTEGEKYVMSVSPVLSFGEQATYDVVNNLGSMAARFIFRPIEDS 325
            .|.:...|..||.||..|||||||||:|||:...||:||:|..||:||||||:.||.||:|:|:|
Mouse   235 VNWKEAGLAWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIVNNLGSLVARLIFQPVEES 299

  Fly   326 SYFYFTQTLSRDIKLAKQPQERVRQASSVLNNLLLGVSSIGLIAFTFGQSYSYPVLLLYGGPDFV 390
            .|.:|.:.|.|:...:.|.|:.|..|::||.:||......||....||.:||...|.:|||....
Mouse   300 FYLFFAKVLEREKDASLQKQDDVAVAAAVLESLLKLALLTGLTMTVFGFAYSQLALDIYGGAMLS 364

  Fly   391 AGGLPQSLLQWHCLAIYLLAVNGISEGYMFATNTSRDIDKYNYLMAIFSVSFLVLSYILTGIFGP 455
            :|..| .|::.:||.:.|||:||::|.:|||..:..::|:||:.|...|.|||||||:||...|.
Mouse   365 SGSGP-VLMRCYCLYVLLLAINGVTECFMFAAMSKEEVDRYNFTMLALSSSFLVLSYLLTSWCGS 428

  Fly   456 VGFIFANCINMLSRILYSTYYIRHQYRPLSLDPLLGL-WPGKLFGCTLFLAGIV--------CYW 511
            ||||.|||.||..||..|..:|.|.:|.....||.|| ....|.|..:..|||.        |..
Mouse   429 VGFIMANCFNMGIRITQSLSFIHHYFRESPHRPLAGLRLSPVLLGVFILSAGITSVSEAFLCCER 493

  Fly   512 YQSSDLATHLGV-----GVLAGLACLLSWALAH 539
            ...:.|| |:.|     ||..|.|.|....|.|
Mouse   494 GWPARLA-HIAVGTICLGVTLGTAFLTETKLIH 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3149NP_572246.1 Rft-1 8..547 CDD:282375 204/548 (37%)
Rft1NP_808483.2 Rft-1 11..524 CDD:282375 203/543 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C221085805
eggNOG 1 0.900 E1_KOG2864
Hieranoid 1 1.000
Homologene 1 1.000 H5343
Inparanoid 1 1.050 303 1.000 Inparanoid score I2631
Isobase 1 0.950 0 Normalized mean entropy S3683
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003801
OrthoInspector 1 1.000 T1085719
orthoMCL 1 0.900 OOG5_129166
Panther 1 1.100 LDO PTHR13117
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1092
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.