DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3149 and rft1

DIOPT Version :8

Sequence 1:NP_572246.1 Gene:CG3149 / 31489 FlyBaseID:FBgn0027564 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_596493.1 Gene:rft1 / 2541221 PomBaseID:SPBC887.19 Length:527 Species:Schizosaccharomyces pombe

Alignment Length:530 Identity:139/531 (26%)
Similarity:220/531 (41%) Gaps:128/531 (24%)


  Fly     4 NVLESSLLGAGFSIIFQILCRILTFGINAYIVRHVGREVLGIMNVRLLLLESTLLFLSREAINRA 68
            ::|:||..|...||.||...|||||.:|...:|..........::...:|:||:||||||::..|
pombe     6 SLLQSSSKGLRSSIFFQGSSRILTFFLNQLTIRLTSPSAYAFSSIHFEILQSTILFLSRESVRLA 70

  Fly    69 ------------ALSANAQQGDRCS-WAQLI-NQMWLTVPICAVL-----------------CAP 102
                        :.|..:.:..:.| ..||| |...::|.|..|:                 ...
pombe    71 MQRIPSENAIITSTSTESNKSKKLSDQLQLIKNTSLISVYIGIVISLLVSLFYFYSLPNFPYSKT 135

  Fly   103 CLYIWLNWLSAVDAIYASQYEFACYAVAFSCVLELMAESAVFVAQVFCFVKLKILLNTLHILVRS 167
            |::|: ...|.::.:....||...:...||     ...||..:..:.|    .:|...:.:|.| 
pombe   136 CIFIY-TVSSFIELLSEPYYEVLQWRQKFS-----KTASAEGLGTIIC----SLLSFAISVLGR- 189

  Fly   168 AIFLWIVTGDRSAAINAFAIAQLSSAVTIVLGQYGFFYFYLKGFKDFVTQQAKKKPVAPKAWQVS 232
                     :::.:...||:..||..|||        :|.|:.|       ||:           
pombe   190 ---------NKAPSSLPFALGNLSEKVTI--------FFTLRYF-------AKQ----------- 219

  Fly   233 LYEHMDDFPFKQLSDFLPGVMFNPNGKHFNRELQTLTL--SFVKQGVLKQILTEGEKYVMS--VS 293
                    ||   |.||..|  ..|.::...:..||.:  |...|.:||.::|:|:|.:::  .|
pombe   220 --------PF---SIFLHKV--GENERYIFWDSSTLRIICSHTYQVLLKHLITKGDKIMVAWYAS 271

  Fly   294 PVLSFGEQATYDVVNNLGSMAARFIFRPIEDSSYFYFTQTLSRDIKLAKQPQERVRQASSVLNNL 358
            |    ..|..|.:.:|.||:.||.:|||:||.|:..|.|......|         :.....||.|
pombe   272 P----SAQGPYALASNYGSLLARIVFRPVEDHSHIVFAQLTHYKNK---------KDEKKALNLL 323

  Fly   359 --LLGVSSIGLIAFTFGQSYSYPVLLLYGGPDFVAGGLPQSLLQWHCLAIYLLAVNGISEG-YMF 420
              :|.:.|...:...||.:|| .::||:|.....|.....|:|.|:.:.|..:|.||:.|. |:.
pombe   324 AWILKLYSYMSLFILFGSNYS-DIVLLFGAGSKWASPDSSSILSWYAMYIPFMAANGVLEAFYVS 387

  Fly   421 ATNTSR--DIDKYNYLMAIFSVSFLVLSYILTGIF-------GPVGFIFANCINMLSRILYSTYY 476
            |.|:|:  |..|.....|:|        |.:||.|       |..|.|.||.:|:..||.::..:
pombe   388 AANSSQLYDQGKCYLASAVF--------YFITGKFLLSWFNLGSHGLILANILNLSLRICFALRF 444

  Fly   477 IRHQYRPLSL 486
            |.|.|:..||
pombe   445 ILHNYKDFSL 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3149NP_572246.1 Rft-1 8..547 CDD:282375 138/527 (26%)
rft1NP_596493.1 MATE_rft1 10..451 CDD:240535 136/522 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H5343
Inparanoid 1 1.050 109 1.000 Inparanoid score I1556
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003801
OrthoInspector 1 1.000 T1126017
orthoMCL 1 0.900 OOG5_129166
Panther 1 1.100 LDO PTHR13117
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1092
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.