DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3149 and rfth-1

DIOPT Version :8

Sequence 1:NP_572246.1 Gene:CG3149 / 31489 FlyBaseID:FBgn0027564 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001023610.1 Gene:rfth-1 / 177216 WormBaseID:WBGene00022677 Length:522 Species:Caenorhabditis elegans

Alignment Length:564 Identity:155/565 (27%)
Similarity:252/565 (45%) Gaps:97/565 (17%)


  Fly    20 QILCRILTFGINAYIVRHVGREVLGIMNVRLLLLESTLLFLSREAINRAALSANAQQGDRCSWAQ 84
            |::.||::|.||.|::|.:..:|||::||||.||.|::|||:||.:.:|.:.       |.|..:
 Worm    14 QLIARIISFAINMYLLRRINNDVLGLVNVRLTLLYSSILFLTREPLRKAEII-------RGSLPK 71

  Fly    85 LINQMWLTVPICAVLCAPCLYIWLNWLSAVDAIYASQYEFACYAVAFSCVLELMAESAVFVAQVF 149
            .||.:||:..|..|:...|:|:|..:.|..|.:        .::|..|..:..:.||   :|:.|
 Worm    72 FINLLWLSPIISTVISVVCVYLWYAFSSTSDEV--------SWSVLLSFPISAIIES---IAEPF 125

  Fly   150 CFVKLKI-----------------LLNTLHILVRSAIFLWIVTGDRSAAINAFAIAQLSSAVTIV 197
            ..:.|::                 |:....|.|.:.:|::    .....:..||.||...|:..:
 Worm   126 SVISLRLESKCGSLAQHFAIGQGMLICVKRIFVLAGLFMF----PGMYHLELFAYAQYIGAIAYL 186

  Fly   198 LGQYGFFYFYLKGFKDFVTQQAKKKPVAPKAWQVSLYEHMDDFPFKQLSDFLPGVMFNPNGKHFN 262
            |..:..||.|:           :.|.: |:..|.|.:.  |.||     .|..|:         :
 Worm   187 LFNFVAFYIYI-----------RNKSI-PELEQFSTFS--DLFP-----KFSEGI---------D 223

  Fly   263 RELQTLTLSFVKQGVLKQILTEGEKYVMSVSPVLSFGEQATYDVVNNLGSMAARFIFRPIEDSSY 327
            |:......:.....:|||:||:|..|||:.:.:||..:||.||.|..:||:..|.|..||:::..
 Worm   224 RDSIHAVFTMFSHSILKQLLTDGSAYVMTFTELLSLKDQAVYDAVERVGSIIVRTILSPIDENCN 288

  Fly   328 FYFTQTLSRDIKLAKQPQERVRQASSVLNNLLLGVSSIGLIAFTFGQSYSYPVLLLYGGPDFVAG 392
            .||:.|:.::..:..:..:........|:.:|..|..||.:|.|||..||..|:.||||......
 Worm   289 AYFSNTIRKESSVFNKNTDNHDDLVDTLSKVLHVVGVIGFVACTFGIPYSPVVISLYGGKLLSEN 353

  Fly   393 GLPQSLLQWHCLAIYLLAVNGISEGYMFATNTSRDIDKYNYLMAIFSVSFLVLSYILTGIFGPVG 457
            | ...||..:...|.:.|:|||:||:..|:..:|.|..:...:.:.|:..|:::|:|.......|
 Worm   354 G-GALLLSLYSGYILVTAINGITEGFAMASMDNRQIFTHGKFLFVTSIIHLIINYVLCVYMNSAG 417

  Fly   458 FIFANCINMLSRILYSTYYIRHQ-------------------YRPLSLDP------LLGLWPGKL 497
            ||.||.|||..||:|:...||..                   :..:||..      |....||..
 Worm   418 FIVANIINMSVRIIYNWRTIREYLGDKCPSFTEVLPTGQTSIFLGVSLLATSFTYLLFATTPGLS 482

  Fly   498 FGCTLFLAGIVCYWYQSSDLATHLGVGVLAGLACLLSWALAHRD 541
            :.......|.||....:.|.|.|..|..:    .:.|.|..|||
 Worm   483 YTLAHIAIGAVCLILTAQDTAQHDSVFTV----IVDSLAKKHRD 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3149NP_572246.1 Rft-1 8..547 CDD:282375 155/565 (27%)
rfth-1NP_001023610.1 MATE_like 2..511 CDD:298879 150/548 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C220689095
eggNOG 1 0.900 E1_KOG2864
Hieranoid 1 1.000
Homologene 1 1.000 H5343
Inparanoid 1 1.050 186 1.000 Inparanoid score I2573
Isobase 1 0.950 0 Normalized mean entropy S3683
OMA 1 1.010
OrthoDB 1 1.010 D338482at33208
OrthoFinder 1 1.000 FOG0003801
OrthoInspector 1 1.000 T477306
orthoMCL 1 0.900 OOG5_129166
Panther 1 1.100 LDO PTHR13117
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1092
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.