DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and HST1

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_014573.1 Gene:HST1 / 854086 SGDID:S000005429 Length:503 Species:Saccharomyces cerevisiae


Alignment Length:311 Identity:71/311 - (22%)
Similarity:119/311 - (38%) Gaps:85/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RLEDF---------LLSKPNVLVLTGAGISTESGIPDYRSEGVGLYARSNHKPVQHME------- 85
            ||.:|         |.:...:|||||||:||..||||:|| ..|.|::..|..::..:       
Yeast   183 RLPNFNTIDHFTATLRNAKKILVLTGAGVSTSLGIPDFRS-SEGFYSKIRHLGLEDPQDVFNLDI 246

  Fly    86 FVKSSAVRKRYWARNFVGWPKFSATQPNATHHALARFEREERVQAVVTQNVDRLHTKAG--SRNV 148
            |::..:|   ::....:..|..:...|  .|..:...:.:.::....|||:|.|.:.||  ...:
Yeast   247 FLQDPSV---FYNIAHMVLPPENMYSP--LHSFIKMLQDKGKLLRNYTQNIDNLESYAGIDPDKL 306

  Fly   149 VEVHGSGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPLEYIENFRIPECTQ 213
            |:.|||.....|::|.::|...:.                           .|.|.|..:|.|..
Yeast   307 VQCHGSFATASCVTCHWQIPGEKI---------------------------FENIRNLELPLCPY 344

  Fly   214 C------------------------------GGDLKPEIVFFGDSVPRPRVDQIAGMVYNSDGLL 248
            |                              .|.|||::.|||:::|......|...:...|.|:
Yeast   345 CYQKRKQYFPMSNGNNTVQTNINFNSPILKSYGVLKPDMTFFGEALPSRFHKTIRKDILECDLLI 409

  Fly   249 VLGSSLLVFSGYRVVLQTKDLKLPVGIVNIG-ETRADHLADIKISAKCGDV 298
            .:|:||.|.....:|..... .:|..::|.. .|.|:.  |:.:...|.||
Yeast   410 CIGTSLKVAPVSEIVNMVPS-HVPQILINRDMVTHAEF--DLNLLGFCDDV 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 70/310 (23%)
HST1NP_014573.1 DUF592 53..207 CDD:368003 6/23 (26%)
SIRT1 201..461 CDD:238699 67/293 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.