| Sequence 1: | NP_572241.2 | Gene: | Sirt4 / 31480 | FlyBaseID: | FBgn0029783 | Length: | 312 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001078550.1 | Gene: | SRT2 / 830782 | AraportID: | AT5G09230 | Length: | 376 | Species: | Arabidopsis thaliana | 
| Alignment Length: | 300 | Identity: | 126/300 - (42%) | 
|---|---|---|---|
| Similarity: | 180/300 - (60%) | Gaps: | 19/300 - (6%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    21 QEYVPHHKPVVEDDIKRLEDFLLSKPNVLVLTGAGISTESGIPDYRSEGVGLYARSNHKPVQHME 85 
  Fly    86 FVKSSAVRKRYWARNFVGWPKFSATQPNATHHALARFEREERVQAVVTQNVDRLHTKAGSRNVVE 150 
  Fly   151 VHGSGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMI---------------RPDGDVEIPL 200 
  Fly   201 EY-IENFRIPECTQCGGDLKPEIVFFGDSVPRPRVDQIAGMVYNSDGLLVLGSSLLVFSGYRVVL 264 
  Fly   265 QTKDLKLPVGIVNIGETRADHLADIKISAKCGDVIPKLFD 304 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Sirt4 | NP_572241.2 | SIRT4 | 38..299 | CDD:238700 | 120/276 (43%) | 
| SRT2 | NP_001078550.1 | SIRT4 | 88..362 | CDD:238700 | 120/276 (43%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 1 | 1.000 | 193 | 1.000 | Domainoid score | I921 | 
| eggNOG | 1 | 0.900 | - | - | E1_COG0846 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 1 | 1.000 | - | - | H8164 | |
| Inparanoid | 1 | 1.050 | 239 | 1.000 | Inparanoid score | I1087 | 
| OMA | 1 | 1.010 | - | - | QHG56570 | |
| OrthoDB | 1 | 1.010 | - | - | D1407693at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0005863 | |
| OrthoInspector | 1 | 1.000 | - | - | oto3272 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_103918 | |
| Panther | 1 | 1.100 | - | - | LDO | PTHR48252 | 
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X4258 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 13 | 12.840 | |||||