DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt4 and SRT2

Sequence 1:NP_572241.2 Gene:Sirt4 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001078550.1 Gene:SRT2 AraportID:AT5G09230 Length:376 Species:Arabidopsis thaliana

Alignment Length:300 Identity:126/300 (42%)
Similarity:180/300 (60%) Gaps:19/300 (6%)


  Fly    21 QEYVPHHKPVVEDDIKRLEDFLLSKPNVLVLTGAGISTESGIPDYRSEGVGLYARSNHKPVQHME 85
            ::.||...|...:||.:|.........:.:|||||:|||.|||||||.. |.|: |..||:.|.|
plant    71 RKIVPDADPPNMEDIHKLYRLFEQSSRLTILTGAGVSTECGIPDYRSPN-GAYS-SGFKPITHQE 133

  Fly    86 FVKSSAVRKRYWARNFVGWPKFSATQPNATHHALARFEREERVQAVVTQNVDRLHTKAGSRNVVE 150
            |.:||..|:|||||::.||.:|:|.||...|.|||..|:..|:..::||||||||.:||| :.:|
plant   134 FTRSSRARRRYWARSYAGWRRFTAAQPGPAHTALASLEKAGRINFMITQNVDRLHHRAGS-DPLE 197

  Fly   151 VHGSGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMI---------------RPDGDVEIPL 200
            :||:.|.|.||.|.:...|..||..|.::||.:.:|.:.|               |||||:||..
plant   198 LHGTVYTVMCLECGFSFPRDLFQDQLKAINPKWAEAIESIDHGDPGSEKSFGMKQRPDGDIEIDE 262

  Fly   201 EY-IENFRIPECTQCGGDLKPEIVFFGDSVPRPRVDQIAGMVYNSDGLLVLGSSLLVFSGYRVVL 264
            :: .|.|.||.|.:|.|.|||:::||||::|:.|..|...:...||..|||||||:..|.:|:..
plant   263 KFWEEGFHIPVCEKCKGVLKPDVIFFGDNIPKERATQAMEVAKQSDAFLVLGSSLMTMSAFRLCR 327

  Fly   265 QTKDLKLPVGIVNIGETRADHLADIKISAKCGDVIPKLFD 304
            ...:......||||||||||.:..:||:|:.|:::.::.|
plant   328 AAHEAGAMTAIVNIGETRADDIVPLKINARVGEILHRVLD 367

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 120/277 (43%)
SRT2NP_001078550.1 SIRT4 88..362 CDD:238700 120/277 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H8164
Inparanoid 1 1.050 240 1.000 Inparanoid score I1055
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T193697
orthoMCL 1 0.900 OOG5_129725
Panther 1 1.100 LDO PTHR43688
Phylome 1 0.910 0.909 Consistency score
87.970

Return to query results.
Submit another query.