DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt4 and Sirt4

Sequence 1:NP_572241.2 Gene:Sirt4 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_006530542.1 Gene:Sirt4 MGIID:1922637 Length:352 Species:Mus musculus

Alignment Length:323 Identity:147/324 (45%)
Similarity:207/324 (64%) Gaps:20/324 (6%)


  Fly     7 LRFRSTSLRSSTARQE---------YVPHHKPVVEDDIKRLEDFLLSKPNVLVLTGAGISTESGI 62
            |.||.|..|..|....         :||...|:..:.||.|:.|:.....:||:|||||||||||
Mouse     4 LTFRPTKGRWITHLSRPRSCGPSGLFVPPSPPLDPEKIKELQRFISLSKKLLVMTGAGISTESGI 68

  Fly    63 PDYRSEGVGLYARSNHKPVQHMEFVKSSAVRKRYWARNFVGWPKFSATQPNATHHALARFEREER 127
            ||||||.||||||::.:|:||::||:|:.||:|||||||||||:||:.|||..|.||:.:||..:
Mouse    69 PDYRSEKVGLYARTDRRPIQHIDFVRSAPVRQRYWARNFVGWPQFSSHQPNPAHWALSNWERLGK 133

  Fly   128 VQAVVTQNVDRLHTKAGSRNVVEVHGSGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMIRP 192
            :..:||||||.||:||||:.:.|:||..:.|.||:|..:..|...|....:|||::......:.|
Mouse   134 LHWLVTQNVDALHSKAGSQRLTELHGCMHRVLCLNCGEQTARRVLQERFQALNPSWSAEAQGVAP 198

  Fly   193 DGDVEIPLEYIENFRIPECTQCGGDLKPEIVFFGDSVPRPRVDQIAGMVYNSDGLLVLGSSLLVF 257
            ||||.:..|.:.:|::|.|.:|||.|||::|||||:|...:||.:...|..:|.|||:||||.|.
Mouse   199 DGDVFLTEEQVRSFQVPCCDRCGGPLKPDVVFFGDTVNPDKVDFVHRRVKEADSLLVVGSSLQVP 263

  Fly   258 SGYRV----------VLQTKDLKLPVGIVNIGETRADHLADIKISAKCGDVIPKLFDFRNSKS 310
            ...||          :|..::.|||:.|:|||.||:|.||.:|:.::||:::| |.|.|...|
Mouse   264 DSVRVAVAFAHPTGFILTAREQKLPIAILNIGPTRSDDLACLKLDSRCGELLP-LIDPRRQHS 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 131/271 (48%)
Sirt4XP_006530542.1 SIRT4 44..315 CDD:238700 134/275 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C188469002
eggNOG 1 0.900 E1_COG0846
Hieranoid 1 1.000
Homologene 1 1.000 H8164
Inparanoid 1 1.050 295 1.000 Inparanoid score I2715
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005183
OrthoInspector 1 1.000 T1083362
orthoMCL 1 0.900 OOG5_129725
Panther 1 1.100 LDO PTHR43688
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2794
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.