DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt4 and Sirt2

Sequence 1:NP_572241.2 Gene:Sirt4 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_017167703.1 Gene:Sirt2 MGIID:1927664 Length:518 Species:Mus musculus

Alignment Length:232 Identity:57/233 (24%)
Similarity:85/233 (36%) Gaps:87/233 (37%)


  Fly    48 VLVLTGAGIST--------------------------------ESGIPDYRSEGVGLYA--RSNH 78
            |:.|.||||||                                .:||||:||...||||  ...|
Mouse   120 VICLVGAGISTCKFPVLQPLLGLGEAGGVRAHVGRASDCVAFLAAGIPDFRSPSTGLYANLEKYH 184

  Fly    79 KP----VQHMEFVKSS-----AVRKRYWARNFVGWPKFSATQPNATHHALARFEREERVQAVVTQ 134
            .|    :..:.:.|..     |:.|..:...|         :|...|:.:...:.:..:....||
Mouse   185 LPYPEAIFEISYFKKHPEPFFALAKELYPGQF---------KPTICHYFIRLLKEKGLLLRCYTQ 240

  Fly   135 NVDRLHTKAG--SRNVVEVHGSGYVVKCL--SC--EYRIDRHEFQSILASLNPAFKDAPDMIRPD 193
            |:|.|...||  .:::||.||:.|...|:  ||  ||.:...:                      
Mouse   241 NIDTLERVAGLEPQDLVEAHGTFYTSHCVNTSCRKEYTMGWMK---------------------- 283

  Fly   194 GDVEIPLEYIENFRIPECTQCGGDLKPEIVFFGDSVP 230
                   |.|.:...|.|.||...:||:|||||:::|
Mouse   284 -------EKIFSEATPRCEQCQSVVKPDIVFFGENLP 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 57/233 (24%)
Sirt2XP_017167703.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.