DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt4 and si:dkey-103i16.6

Sequence 1:NP_572241.2 Gene:Sirt4 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001038173.1 Gene:si:dkey-103i16.6 ZFINID:ZDB-GENE-061207-46 Length:373 Species:Danio rerio

Alignment Length:271 Identity:76/272 (28%)
Similarity:117/272 (43%) Gaps:57/272 (21%)


  Fly    47 NVLVLTGAGISTESGIPDYRSEGVGLYARSNHKPVQHMEFVKSSAVRKRYWARNFVGWPKFSAT- 110
            |::|:.||||||.|||||:|:.|.||||......:.:.|.|    ....|::.|  ..|.||.. 
Zfish    94 NIVVVAGAGISTASGIPDFRTPGTGLYANLAKYDIPYPEAV----FNIDYFSDN--PHPFFSLAK 152

  Fly   111 -------QPNATHHALARFEREERVQAVVTQNVDRLHTKAG--SRNVVEVHGSGYVVKCLSCEYR 166
                   :||..|:.:....::..:..:.|||:|.|....|  ...:||.|||.....|..|   
Zfish   153 ELYPGHHRPNYVHYFIRMLHQKGLLLRMYTQNIDGLEKLCGIPDDKLVEAHGSFATAACHLC--- 214

  Fly   167 IDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPLEYIENFRIPECTQCGGDLKPEIVFFGDSVPR 231
                            :...|        .|...:.|.|..:|.||.|.|.:||.:||||:.:|.
Zfish   215 ----------------YTPYP--------AEEAKQAIMNGSVPICTFCAGAVKPNVVFFGEDLPE 255

  Fly   232 PRVDQIAGMVYNSDGLLVLGSSLLV--FSGYRVVLQTKDLKLPVGIVN---IGE------TRADH 285
             :..|.|.....:|.|:::|:||.|  ...:..::.|....:|..::|   :|.      .|||:
Zfish   256 -KYFQHAEDFPKADLLMIMGTSLKVGLIEPFASLINTVKSTVPRLLLNRDAVGPFERRPLRRADY 319

  Fly   286 --LADIKISAK 294
              |.|:..|.:
Zfish   320 MELGDLSESVR 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 76/272 (28%)
si:dkey-103i16.6NP_001038173.1 SIRT1 93..332 CDD:238699 76/272 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.