DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt4 and Sirt6

Sequence 1:NP_572241.2 Gene:Sirt4 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_006513924.1 Gene:Sirt6 MGIID:1354161 Length:390 Species:Mus musculus

Alignment Length:288 Identity:74/289 (26%)
Similarity:122/289 (42%) Gaps:68/289 (24%)


  Fly    31 VEDDIKRLEDFLLSKPNVLVLTGAGISTESGIPDYRS-EGVGLYARSNHKPVQHMEFVKSSAVRK 94
            :|..:..|...:....:|:..|||||||.|||||:|. .||                        
Mouse    86 LERKVWELARLMWQSSSVVFHTGAGISTASGIPDFRGPHGV------------------------ 126

  Fly    95 RYWARNFVGW-PKFSAT----QPNATHHALARFEREERVQAVVTQNVDRLHTKAG--SRNVVEVH 152
              |.....|. |||..|    :|:.||.||.:.||...:..:|:||||.||.::|  ...:.|:|
Mouse   127 --WTMEERGLAPKFDTTFENARPSKTHMALVQLERMGFLSFLVSQNVDGLHVRSGFPRDKLAELH 189

  Fly   153 GSGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPLEYIENFRIPECT----- 212
            |:.:|.:|..|:.:..|   .:::.::.         ::..|.:              ||     
Mouse   190 GNMFVEECPKCKTQYVR---DTVVGTMG---------LKATGRL--------------CTVAKTR 228

  Fly   213 ---QCGGDLKPEIVFFGDSVPRPRVDQIAGMVYNSDGLLVLGSSLLVFSGYRVVLQTKDLKLPVG 274
               .|.|:|:..|:.:.||:|...:.........:|..:.||:||.:.....:.|.||.....:.
Mouse   229 GLRACRGELRDTILDWEDSLPDRDLMLADEASRTADLSVTLGTSLQIRPSGNLPLATKRRGGRLV 293

  Fly   275 IVNIGETRADHLADIKISAKCGDVIPKL 302
            |||:..|:.|..||::|.....:|:.:|
Mouse   294 IVNLQPTKHDRQADLRIHGYVDEVMCRL 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 72/277 (26%)
Sirt6XP_006513924.1 SIRT7 101..313 CDD:238701 70/264 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.