DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and Sirt6

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001365873.1 Gene:Sirt6 / 50721 MGIID:1354161 Length:334 Species:Mus musculus


Alignment Length:288 Identity:74/288 - (25%)
Similarity:122/288 - (42%) Gaps:68/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VEDDIKRLEDFLLSKPNVLVLTGAGISTESGIPDYRS-EGVGLYARSNHKPVQHMEFVKSSAVRK 94
            :|..:..|...:....:|:..|||||||.|||||:|. .||                        
Mouse    30 LERKVWELARLMWQSSSVVFHTGAGISTASGIPDFRGPHGV------------------------ 70

  Fly    95 RYWARNFVGW-PKFSAT----QPNATHHALARFEREERVQAVVTQNVDRLHTKAG--SRNVVEVH 152
              |.....|. |||..|    :|:.||.||.:.||...:..:|:||||.||.::|  ...:.|:|
Mouse    71 --WTMEERGLAPKFDTTFENARPSKTHMALVQLERMGFLSFLVSQNVDGLHVRSGFPRDKLAELH 133

  Fly   153 GSGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPLEYIENFRIPECT----- 212
            |:.:|.:|..|:.:..|   .:::.::.         ::..|.:              ||     
Mouse   134 GNMFVEECPKCKTQYVR---DTVVGTMG---------LKATGRL--------------CTVAKTR 172

  Fly   213 ---QCGGDLKPEIVFFGDSVPRPRVDQIAGMVYNSDGLLVLGSSLLVFSGYRVVLQTKDLKLPVG 274
               .|.|:|:..|:.:.||:|...:.........:|..:.||:||.:.....:.|.||.....:.
Mouse   173 GLRACRGELRDTILDWEDSLPDRDLMLADEASRTADLSVTLGTSLQIRPSGNLPLATKRRGGRLV 237

  Fly   275 IVNIGETRADHLADIKISAKCGDVIPKL 302
            |||:..|:.|..||::|.....:|:.:|
Mouse   238 IVNLQPTKHDRQADLRIHGYVDEVMCRL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 71/276 (26%)
Sirt6NP_001365873.1 SIRT7 45..257 CDD:238701 70/263 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.