DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt4 and sirt6

Sequence 1:NP_572241.2 Gene:Sirt4 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_989353.1 Gene:sirt6 XenbaseID:XB-GENE-5929105 Length:331 Species:Xenopus tropicalis

Alignment Length:291 Identity:77/292 (26%)
Similarity:124/292 (42%) Gaps:59/292 (20%)


  Fly    28 KPVVEDDIKRLEDFLLSKPNVLVLTGAGISTESGIPDYRS-EGVGLYARSNHKPVQHMEFVKSSA 91
            :.|||     |.|.:.....|:..|||||||..||||:|. .||                     
 Frog    32 RKVVE-----LADMIRKSSYVVFHTGAGISTSCGIPDFRGPNGV--------------------- 70

  Fly    92 VRKRYWARNFVGW-PKFSAT----QPNATHHALARFEREERVQAVVTQNVDRLHTKAG--SRNVV 149
                 |.....|. |||..|    .|:.||.||.:.:|...::.:|:||||.||.::|  ...:.
 Frog    71 -----WTLEEKGVNPKFDITFESACPSPTHMALLQLQRVGILKFLVSQNVDGLHVRSGFPREQLA 130

  Fly   150 EVHGSGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDV-EIPLEYIENFRIPECTQ 213
            |:||:.:|.:|..|..:..|.:....:.            ::|.|.: ::|       ::.....
 Frog   131 ELHGNMFVEECSKCSKQYVRDQVVGTMG------------LKPTGRLCDVP-------KVRGLRA 176

  Fly   214 CGGDLKPEIVFFGDSVPRPRVDQIAGMVYNSDGLLVLGSSLLVFSGYRVVLQTKDLKLPVGIVNI 278
            |.|.||..|:.:.||:|...::........:|..:.||:||.:.....:.|.||.....:.|||:
 Frog   177 CRGKLKDTILDWEDSLPDRDLNLADEACRKADLSITLGTSLQIRPSGNLPLLTKRKGGKLVIVNL 241

  Fly   279 GETRADHLADIKISAKCGDVIPKLFDFRNSK 309
            ..|:.|..||::|.....:|:.:|.:....|
 Frog   242 QPTKHDKHADLRIHGYVDEVMTQLMELLGHK 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 72/270 (27%)
sirt6NP_989353.1 SIRT7 45..257 CDD:238701 69/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.