DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt4 and sir-2.4

Sequence 1:NP_572241.2 Gene:Sirt4 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_491733.2 Gene:sir-2.4 WormBaseID:WBGene00004803 Length:292 Species:Caenorhabditis elegans

Alignment Length:300 Identity:70/300 (23%)
Similarity:118/300 (39%) Gaps:60/300 (20%)


  Fly    28 KPVVEDD----IKRL----EDFLLSKPN---VLVLTGAGISTESGIPDYR-SEGV-GLYARSNHK 79
            ||.:.|.    |::|    ..|:.:|..   :.||.|||:||.|.:||:| .:|| .|.|..   
 Worm    20 KPEIRDTETEIIEKLRTLYNHFVQAKQTGKPIFVLIGAGVSTGSKLPDFRGKQGVWTLQAEG--- 81

  Fly    80 PVQHMEFVKSSAVRKRYWARNFVGWPKFSATQPNATHHALARFEREERVQAVVTQNVDRLHTKAG 144
              :|.|.|                  .|...:|..:|.::....:...::.::|||||.|..|.|
 Worm    82 --KHAEGV------------------DFQVARPGVSHKSILALHKAGYIKTIITQNVDGLDRKVG 126

  Fly   145 --SRNVVEVHGSGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPLEYIENFR 207
              ..:::||||:.::..|.||.....|.|. .:...|.|..::.....|..              
 Worm   127 IPVEDLIEVHGNLFLEVCQSCFSEYVREEI-VMSVGLCPTGRNCEGNKRTG-------------- 176

  Fly   208 IPECTQCGGDLKPEIVFFGDSVPRPRVDQIAGMVYNSDGLLVLGSSLLVFSGYRVVLQTKDLKLP 272
                ..|.|.|:...:.:...:....:|:|......:..||.:|:||.:.....:.|..|...:.
 Worm   177 ----RSCRGKLRDATLDWDTEISLNHLDRIRKAWKQTSHLLCIGTSLEIIPMGSLPLDAKSKGIK 237

  Fly   273 VGIVNIGETRADHLADIKISAKCGDVIPKLFDFRNSKSVS 312
            ...:|..||..:.:.:..|.|   ||...|:...|:..|:
 Worm   238 TTTINYQETAHEKIVETAIHA---DVKLILYSLCNALGVN 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 63/272 (23%)
sir-2.4NP_491733.2 SIR2 49..259 CDD:294129 58/255 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.