DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sirt4 and sirt2

Sequence 1:NP_572241.2 Gene:Sirt4 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_002935827.3 Gene:sirt2 XenbaseID:XB-GENE-987375 Length:414 Species:Xenopus tropicalis

Alignment Length:297 Identity:76/298 (26%)
Similarity:125/298 (42%) Gaps:70/298 (23%)


  Fly    28 KPVVEDDIKRLEDFLLSK--PNVLVLTGAGISTESGIPDYRSEGVGLYARSNHKPVQHME----- 85
            |.:.|..|:.:..|:||:  .||:.:.||||||.:||||:||.|.|||:......:.:.|     
 Frog    86 KVLDELSIEGISRFMLSEKCKNVVCMVGAGISTSAGIPDFRSPGSGLYSNLQKYNLPYPEAIFQI 150

  Fly    86 -FVKSS-----AVRKRYWARNFVGWPKFSATQPNATHHALARFEREERVQAVVTQNVDRLHTKAG 144
             :.|.:     |:.:..:...|         :|...|:.:...:.:..:....:||:|.|...||
 Frog   151 GYFKENPEPFFALARELFPGQF---------KPTICHYFIRLLKEKGLLLRCYSQNIDTLERVAG 206

  Fly   145 --SRNVVEVHGSGYVVKCLS----CEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPLEYI 203
              |.::||.||:.:...|:.    .||.:...: :.|.:.|                        
 Frog   207 LTSDDLVEAHGTFHSSHCVDTFCRAEYSLSWMK-EKIFSDL------------------------ 246

  Fly   204 ENFRIPECTQCGGDLKPEIVFFGDSVPRPRVDQIAGMVYNSDGLLVLGSSLLVFSGYRVVLQTKD 268
                ||:|.:|...:||:|||||:|:|......|.......|.|:|:|:||.| ..:..::....
 Frog   247 ----IPKCEKCNNLVKPDIVFFGESLPSRFFSAIKSDFPKVDLLIVMGTSLQV-QPFASLVSKVS 306

  Fly   269 LKLPVGIVNIGETRADHLADIKISAKCGDVIPKLFDF 305
            .|.|..::|            |..|..||....:|.|
 Frog   307 SKTPRLLIN------------KELAGQGDPFFSVFGF 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 71/280 (25%)
sirt2XP_002935827.3 SIRT1 106..359 CDD:238699 70/278 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.