DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and AT1G18530

DIOPT Version :10

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_173288.1 Gene:AT1G18530 / 838434 AraportID:AT1G18530 Length:157 Species:Arabidopsis thaliana


Alignment Length:154 Identity:32/154 - (20%)
Similarity:71/154 - (46%) Gaps:33/154 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDV-----------------KKCTHQLK 62
            :.:.::.|:.||...||.:.:.::...||:||..|:...:                 .:....:.
plant     5 IRQLKDIFDRFDMDADGSLTILELAALLRSLGLKPSGDQIHVLLASMDSNGNGFVEFDELVGTIL 69

  Fly    63 PDERISFEVFLPIYQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEV 127
            ||  ::.||.:             .::..:|..:.||:|.:|:||:|||...:..:|:.||.:|:
plant    70 PD--LNEEVLI-------------NSEQLLEIFKSFDRDGNGFISAAELAGAMAKMGQPLTYKEL 119

  Fly   128 EQLLANME-DQQGNINYEEFVRMV 150
            .:::...: :..|.|::.||..::
plant   120 TEMIKEADTNGDGVISFGEFASIM 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 32/154 (21%)
AT1G18530NP_173288.1 PTZ00184 2..143 CDD:185504 32/152 (21%)

Return to query results.
Submit another query.