DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and CAM7

DIOPT Version :10

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001326523.1 Gene:CAM7 / 823492 AraportID:AT3G43810 Length:214 Species:Arabidopsis thaliana


Alignment Length:141 Identity:63/141 - (44%)
Similarity:96/141 - (68%) Gaps:5/141 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDER--ISFEVFLPIYQ 77
            :.||:|||:|||..|||.|...::|..:|:|||||||::::...:::..|..  |.|..||.:  
plant    10 ISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNL-- 72

  Fly    78 AISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANME-DQQGNI 141
            ...|.:..|:.::..|..|.||||.:|:||:|||||::|.||||||||||::::...: |..|.|
plant    73 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQI 137

  Fly   142 NYEEFVRMVMS 152
            ||||||:::|:
plant   138 NYEEFVKVMMA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 62/139 (45%)
CAM7NP_001326523.1 PTZ00184 1..149 CDD:185504 63/141 (45%)

Return to query results.
Submit another query.