DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and CALML3

DIOPT Version :10

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_005176.1 Gene:CALML3 / 810 HGNCID:1452 Length:149 Species:Homo sapiens


Alignment Length:139 Identity:61/139 - (43%)
Similarity:93/139 - (66%) Gaps:5/139 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDER--ISFEVFLPIYQAI 79
            ||:|||:|||..|||.|...::|..:|:|||||||::::....::..|..  :.|..||.:  ..
Human    12 EFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGM--MA 74

  Fly    80 SKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLL-ANMEDQQGNINY 143
            .|.:..|..::..|..|.||||.:|::|:|||||::|.|||||:||||:::: |...|..|.:||
Human    75 RKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNY 139

  Fly   144 EEFVRMVMS 152
            |||||:::|
Human   140 EEFVRVLVS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 60/137 (44%)
CALML3NP_005176.1 PTZ00184 1..149 CDD:185504 61/139 (44%)

Return to query results.
Submit another query.