DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and CETN1

DIOPT Version :10

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_004057.1 Gene:CETN1 / 1068 HGNCID:1866 Length:172 Species:Homo sapiens


Alignment Length:138 Identity:48/138 - (34%)
Similarity:79/138 - (57%) Gaps:5/138 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPD--ERISFEVFLPIYQA 78
            :|.:|||:|||..|.|.|...::...:||||..|.:.::||...::..:  .:|||..||.:  .
Human    31 QEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAV--M 93

  Fly    79 ISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANME-DQQGNIN 142
            ..|....||.::.::..|.||.|.:|.||...|:.:...|||.|||||:::::...: |..|.:|
Human    94 TQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVN 158

  Fly   143 YEEFVRMV 150
            .|||:|::
Human   159 EEEFLRIM 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 48/138 (35%)
CETN1NP_004057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 48/138 (35%)
PTZ00183 22..172 CDD:185503 48/138 (35%)

Return to query results.
Submit another query.