DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34434 and Myl4

DIOPT Version :8

Sequence 1:NP_001096887.1 Gene:CG34434 / 31472 FlyBaseID:FBgn0250904 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001102965.1 Gene:Myl4 / 688228 RGDID:1591197 Length:193 Species:Rattus norvegicus

Alignment Length:42 Identity:9/43 (21%)
Similarity:18/43 (42%) Gaps:2/43 (5%)


  Fly   410 VYHRPDDAVILEAEDDRIYVVGALERNVRYVHAEVVQEGNED 451
            |:.:..:..::.||  ..:|:..|...:.....|.:..|.||
  Rat   137 VFDKESNGTVMGAE--LRHVLATLGEKMSEAEVEQLLTGQED 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34434NP_001096887.1 None
Myl4NP_001102965.1 PTZ00184 45..192 CDD:185504 9/43 (21%)
EFh 130..191 CDD:238008 9/43 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.