powered by:
Protein Alignment CG34434 and Myl4
DIOPT Version :9
Sequence 1: | NP_001096887.1 |
Gene: | CG34434 / 31472 |
FlyBaseID: | FBgn0250904 |
Length: | 460 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_030101494.1 |
Gene: | Myl4 / 17896 |
MGIID: | 97267 |
Length: | 205 |
Species: | Mus musculus |
Alignment Length: | 121 |
Identity: | 26/121 - (21%) |
Similarity: | 38/121 - (31%) |
Gaps: | 47/121 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 310 APVAGAFPDTVGDGAPVAVAGAATDGGGGGEGPSTSAAAPGNIQLDVQTYTHSLSFVQQQDGSHE 374
||.|.|.|:.:.| ||..|.::::|.. ..|.:.||
Mouse 20 APAASAAPEPLKD----------------------SAFDPKSVKIDFS--------ADQIEVSH- 53
Fly 375 VYTSCDLVTDEEQMAPMREI-----RVEDGELVILAGDDG-----VYHRPDDAVIL 420
|...|...|..:|. |...||:.|..|..| :...|.:|.:|
Mouse 54 ------LPIGEAVAAEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVL 103
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG34434 | NP_001096887.1 |
None |
Myl4 | XP_030101494.1 |
PTZ00184 |
62..204 |
CDD:185504 |
11/42 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0030 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.