DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34434 and Myl4

DIOPT Version :9

Sequence 1:NP_001096887.1 Gene:CG34434 / 31472 FlyBaseID:FBgn0250904 Length:460 Species:Drosophila melanogaster
Sequence 2:XP_030101494.1 Gene:Myl4 / 17896 MGIID:97267 Length:205 Species:Mus musculus


Alignment Length:121 Identity:26/121 - (21%)
Similarity:38/121 - (31%) Gaps:47/121 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 APVAGAFPDTVGDGAPVAVAGAATDGGGGGEGPSTSAAAPGNIQLDVQTYTHSLSFVQQQDGSHE 374
            ||.|.|.|:.:.|                      ||..|.::::|..        ..|.:.|| 
Mouse    20 APAASAAPEPLKD----------------------SAFDPKSVKIDFS--------ADQIEVSH- 53

  Fly   375 VYTSCDLVTDEEQMAPMREI-----RVEDGELVILAGDDG-----VYHRPDDAVIL 420
                  |...|...|..:|.     |...||:.|..|..|     :...|.:|.:|
Mouse    54 ------LPIGEAVAAEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVL 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34434NP_001096887.1 None
Myl4XP_030101494.1 PTZ00184 62..204 CDD:185504 11/42 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.