DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sas10 and SAS10

DIOPT Version :8

Sequence 1:NP_572215.1 Gene:Sas10 / 31447 FlyBaseID:FBgn0029755 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_010128.1 Gene:SAS10 / 851403 SGDID:S000002312 Length:610 Species:Saccharomyces cerevisiae

Alignment Length:621 Identity:137/622 (22%)
Similarity:222/622 (36%) Gaps:237/622 (38%)


  Fly     6 DDY------VMSGSDQEYD---DEEREILEDLRKQRKKPHDPVQEVLGFSDDDD--DDDDDDEEE 59
            ||:      |:.|.....|   |::..:|||         :..:|||...:||:  |:.:|:|||
Yeast    27 DDFASKREKVLLGQSTFGDSNKDDDHSLLED---------EDEEEVLAMDEDDESIDEREDEEEE 82

  Fly    60 QQDVAELMRDSDIEGA-----------------EDDDRD--LPNTMDWGSKRSTYYNTDFVDQDY 105
            :::        :::||                 |:|:.:  |.|...|||.:..||..|.:|.| 
Yeast    83 EEE--------ELDGAAAYKKIFGRNLETDQLPEEDEENGMLDNENAWGSTKGEYYGADDLDDD- 138

  Fly   106 SSYNAQEEEQARAEEEEAKKIQLRLAKRMSEADFQLDNVE----AAPAGSSDDNELSHITKVT-- 164
                    |.|:..|:||.:.|.:..:.::..|: ||..|    ...|...|..|..:.||..  
Yeast   139 --------EAAKEIEKEALRQQKKHLEELNMNDY-LDEEEEEEWVKSAKEFDMGEFKNSTKQADT 194

  Fly   165 ----SDLAGLSERERRQLMHSESPEFIILTQDFQQHLDEVKNLLKPVLNYVRKHDVPMVPALQYA 225
                :|:..:.:..|...:.:..|||..|:::|.:...:...|.|...|...|  :.::....|.
Yeast   195 KTSITDILNMDDEARDNYLRTMFPEFAPLSKEFTELAPKFDELKKSEENEFNK--LKLIALGSYL 257

  Fly   226 GLCHTVLTTYCSNVAFYLLLKARRIDVKAHPVIRRLVQLKDL----------------------- 267
            |    .::.|.|.:...|........:|.|||:.:::..|::                       
Yeast   258 G----TISCYYSILLHELHNNEDFTSMKGHPVMEKILTTKEIWRQASELPSSFDVNEGDGSESEE 318

  Fly   268 -----------IEELK-----------------------------------PRYEEYI------- 279
                       :.||:                                   ..:|||:       
Yeast   319 TANIEAFNEKKLNELQNSEDSDAEDGGKQKQEIDEEERESDEEEEEEDVDIDDFEEYVAQSRLHS 383

  Fly   280 RPQLEALLERIEDGDAFTVLDVA-----QRKAKLQILNKYND--GQQASVSSDDDDNDDD----- 332
            :|:..::.|    .|.|...::|     .:||:.:.|..|..  .||.:..:|....|||     
Yeast   384 KPKTSSMPE----ADDFIESEIADVDAQDKKARRRTLRFYTSKIDQQENKKTDRFKGDDDIPYKE 444

  Fly   333 -----------------------DDAESKEKDLQEEA--------GE------------------ 348
                                   .|.:.|:...::||        ||                  
Yeast   445 RLFERQQRLLDEARKRGMHDNNGADLDDKDYGSEDEAVSRSINTQGENDYYQQVQRGKQDKKISR 509

  Fly   349 --------------------EEEEEDARRGITYQMAKNKGLTPHRKKELRNPRVKHRGKYRKALI 393
                                |....|.:|.|.||:.|||||||.|.|:.||.|||.|.||:||..
Yeast   510 KEAHKNAVIAAREGKLAELAENVSGDGKRAINYQILKNKGLTPKRNKDNRNSRVKKRKKYQKAQK 574

  Fly   394 RRKGAVRTVRKELQR--YGGELSGIKAGVTKSVKFR 427
            :.| :||.|....|.  |.||.:|||.|:|:||||:
Yeast   575 KLK-SVRAVYSGGQSGVYEGEKTGIKKGLTRSVKFK 609

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sas10NP_572215.1 Sas10_Utp3 191..269 CDD:281929 15/112 (13%)
Sas10 354..426 CDD:286457 40/74 (54%)
SAS10NP_010128.1 Sas10_Utp3 220..296 CDD:309214 17/82 (21%)
Sas10 535..608 CDD:312764 40/74 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C205544037
eggNOG 1 0.900 E1_KOG3118
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I1626
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004514
OrthoInspector 1 1.000 T1136106
orthoMCL 1 0.900 OOG5_128418
Panther 1 1.100 LDO PTHR13237
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1729
TreeFam 1 0.960
109.870

Return to query results.
Submit another query.