DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and TY1

DIOPT Version :10

Sequence 1:NP_511046.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_177802.2 Gene:TY1 / 844010 AraportID:AT1G76760 Length:172 Species:Arabidopsis thaliana


Alignment Length:94 Identity:30/94 - (31%)
Similarity:49/94 - (52%) Gaps:13/94 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KRIEAA-------------DDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFE 63
            :||||.             .||.:::|:||||||||:.|...:..::.....|..|:|||.:|:.
plant    61 RRIEAKKQTFDSFEDLLVNSDKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYP 125

  Fly    64 ELTERYKVRSMPTFVFLRQNRRLASFAGA 92
            .:..:||:.::|||:..:.......|.||
plant   126 SIANKYKIEALPTFILFKDGEPCDRFEGA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_511046.1 CnoX 6..105 CDD:442352 30/94 (32%)
TY1NP_177802.2 CnoX 69..168 CDD:442352 26/86 (30%)

Return to query results.
Submit another query.